TkA01G079590 | RubberDandelionOmics

Gene overview

TkA01G079590

Reference: TK1151 Chr: Chr01 Coordinates: 20374983-20375327 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

345 bp · TkA01G079590|TK1151|cDNA

ATGAACTCCCACCTCCGCCGTGAAATTATCCGCTACGGTGAGCTCGCTCAAGCTTGCTACGACTCGTTTGATTTTGACCCGCGATCGAAATACTGTGGAACTTGTAAATACATAGGGACTCATTTCTTCGAGAAGCTTGATATGGCTGATCGTGGGTACAGTATTCATCGTTACCTTTATGCTACCTCCAACATTAATCTCCCGAATTTCTTTCAAAAATCGAAGTTATCGAGTGTTTGGAGCCAACACGCGAATTGGAT...

CDS

Download CDS FASTA

345 bp · TkA01G079590|TK1151|CDS

ATGAACTCCCACCTCCGCCGTGAAATTATCCGCTACGGTGAGCTCGCTCAAGCTTGCTACGACTCGTTTGATTTTGACCCGCGATCGAAATACTGTGGAACTTGTAAATACATAGGGACTCATTTCTTCGAGAAGCTTGATATGGCTGATCGTGGGTACAGTATTCATCGTTACCTTTATGCTACCTCCAACATTAATCTCCCGAATTTCTTTCAAAAATCGAAGTTATCGAGTGTTTGGAGCCAACACGCGAATTGGAT...

Protein

Download Protein FASTA

114 aa · TkA01G079590|TK1151|PROTEIN

MNSHLRREIIRYGELAQACYDSFDFDPRSKYCGTCKYIGTHFFEKLDMADRGYSIHRYLYATSNINLPNFFQKSKLSSVWSQHANWMGYVAVATDEDEIQRLGRRDVVIAWREL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G079590`
TK1151 ID	TkA01G079590
OH-1004 ID	LXL04_027553
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	48.200
Protein coverage (%)	TK1151 98.246 / OH-1004 18.049 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G079590

Location Chr01:20374983-20375327 (-)

Description Similar to At1g06800: Phospholipase A1-Igamma1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g51440`	Acylhydrolase that catalyzes the hydrolysis of phosphatidylcholine at the sn-1 position.	No verified direct reference in this release
`At2g30550`	Acylhydrolase with broad specificity.	No verified direct reference in this release
`At1g06800`	Acylhydrolase with a broad specificity.	DONGLE and DEFECTIVE IN ANTHER DEHISCENCE1 lipases are not essential for wound- and pathogen-induced jasmonate biosynthesis: redundant lipases contribute to jasmonate formation.2010 · DOI: 10.1104/pp.110.155093

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2WT95`	Acylhydrolase that catalyzes the hydrolysis of phospholipids at the sn-1 position.	No verified direct reference in this release
`Os01g0651100`	Acylhydrolase that catalyzes the hydrolysis of phospholipids at the sn-1 position.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027553 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016042 lipid catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004620 glycerophospholipase activity Molecular Function

GO:0004806 triacylglycerol lipase activity Molecular Function

GO:0008970 glycerophospholipid phospholipase A1 activity Molecular Function

GO:0047714 galactolipase activity Molecular Function

KEGG gene cross-reference

ath:AT1G06800

ath:AT1G51440

ath:AT2G30550

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.432

Rank 1 · TkA01G079590 · TK1151

Nucleus0.189

Rank 2 · TkA01G079590 · TK1151

Lysosome / Vacuole0.116

Rank 3 · TkA01G079590 · TK1151

Extracellular0.115

Rank 4 · TkA01G079590 · TK1151

Plastid0.104

Rank 5 · TkA01G079590 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21549PRDM2_PR81-98 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G079590	`PF21549`	PRDM2_PR	81	98	0.17	12.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C8J6`	Arabidopsis thaliana	sp\|Q9C8J6\|PLA17_ARATH Phospholipase A1-Igamma3, chloroplastic	79.600%	Swiss-Prot	High
`Q3EBR6`	Arabidopsis thaliana	sp\|Q3EBR6\|PLA16_ARATH Phospholipase A1-Igamma2, chloroplastic	67.000%	Swiss-Prot	High
`Q941F1`	Arabidopsis thaliana	sp\|Q941F1\|PLA15_ARATH Phospholipase A1-Igamma1, chloroplastic	63.700%	Swiss-Prot	High
`A2WT95`	Oryza sativa subsp. indica	sp\|A2WT95\|PLA1_ORYSI Phospholipase A1-II 1	45.500%	Swiss-Prot	Medium
`A2ZW16`	Oryza sativa subsp. japonica	sp\|A2ZW16\|PLA1_ORYSJ Phospholipase A1-II 1	45.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card