Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1977 bp · TkA01G076120|TK1151|cDNA
TTATTGTCGTTAATTAGTTGGCATATTCCAGCAATACTTCAAAAAAAAAATTTAATTTTTTTTAATTTTTTTTTCACTTTCTCTATCATAAATGTTCATACATGTTACATACCCTCTTGCTTGTTTCAGAGTTCCATTTCACATTCACCGCCATTTACTTCATCGTTCACATTAGTTTCTCTCTCTCTCTCTCTCTAATTGCTTATTGCAGACTCTTCAATTTCTTGCAGGTTTTCGTATTTTTAAGAGTGTGAAAGGTT...
1422 bp · TkA01G076120|TK1151|CDS
ATGCAGACTCCAAAAATAAGCGTAAAGAGCACCGAAAGTGGTAGGAGGATCTCTCCTAGATCTGTTTCTTCGGAAACTAAACAAAGGAGTAGTGGTCGTGTTGTTCGACAACTAAAGACAAGTGGCCTTGAAGTCAACTTTTCTTCAACTAGTACTACACCAAAAGCAACAAGTGCTAAAATCGTTCATCGTACATCACCAAGAGGCCTTGATCTTGAGAAAAAGCGTCCAGGAAGAGTCGCCGAACTTGAAACCCAGAT...
Protein
Download Protein FASTA473 aa · TkA01G076120|TK1151|PROTEIN
MQTPKISVKSTESGRRISPRSVSSETKQRSSGRVVRQLKTSGLEVNFSSTSTTPKATSAKIVHRTSPRGLDLEKKRPGRVAELETQISQLEDALRTVKDQLIVSESWKKQAKLDAEESRKELLAITSRLEESQKLLPPSSSSSNEDHSNCQSEEIRVLKESLAEKVSLMEEMKNTLDDCRSSESQAQALASETLQQLETARKTMESLKLTNDGYNGIVSELDQSKERVSSLESIIEEMKVNEKQRESDEITALKSELENM...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G076120 |
|---|---|
| TK1151 ID | TkA01G076120 |
| OH-1004 ID | LXL04_005204 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 98.700 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G076120 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:19453112-19458040 (-) | |||||||||
| Description | Similar to ICR3: Interactor of constitutive active ROPs 3 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0009664 plant-type cell wall organization Biological Process GO:0043622 cortical microtubule organization Biological Process GO:2000012 regulation of auxin polar transport Biological Process GO:0005576 extracellular region Cellular Component GO:0005634 nucleus Cellular Component GO:0005874 microtubule Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009507 chloroplast Cellular Component GO:0090404 pollen tube tip Cellular Component GO:0008017 microtubule binding Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT1G17140 ath:AT1G78430 ath:AT2G37080 ath:AT3G53350 ath:AT5G60210 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF09762CCDC93_CC52-210 aaPF25764KIF21A_4th73-101 aaPF30842LEKR176-136 aaPF28422CCDC8979-208 aaPF15905HMMR_N80-208 aaPF07851TMEM120A-B80-177 aaPF24161CCDC3981-133 aaPF27605ODF2_C81-274 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G076120 | PF09762 | CCDC93_CC | 52 | 210 | 1.7 | 8.3 |
| TkA01G076120 | PF25764 | KIF21A_4th | 73 | 101 | 0.018 | 15.5 |
| TkA01G076120 | PF30842 | LEKR1 | 76 | 136 | 1.3 | 10.0 |
| TkA01G076120 | PF28422 | CCDC89 | 79 | 208 | 8.1 | 6.4 |
| TkA01G076120 | PF15905 | HMMR_N | 80 | 208 | 0.0003 | 21.1 |
| TkA01G076120 | PF07851 | TMEM120A-B | 80 | 177 | 0.21 | 11.5 |
| TkA01G076120 | PF24161 | CCDC39 | 81 | 133 | 2.6e-05 | 23.0 |
| TkA01G076120 | PF27605 | ODF2_C | 81 | 274 | 0.62 | 9.9 |
| TkA01G076120 | PF13851 | GAS | 81 | 130 | 2.0 | 8.5 |
| TkA01G076120 | PF27241 | CLIP1 | 81 | 197 | 3.7 | 8.3 |
| TkA01G076120 | PF04977 | DivIC | 82 | 99 | 0.0016 | 18.9 |
| TkA01G076120 | PF10473 | CENP-F_leu_zip | 82 | 208 | 0.057 | 14.2 |
| TkA01G076120 | PF03902 | Gal4_dimer | 82 | 96 | 0.8 | 10.6 |
| TkA01G076120 | PF27682 | ICR5_C | 88 | 111 | 5.2e-17 | 63.3 |
| TkA01G076120 | PF05667 | CCDC22_CC | 89 | 237 | 7.9 | 6.2 |
| TkA01G076120 | PF25764 | KIF21A_4th | 108 | 241 | 0.018 | 15.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.