TkA01G075780 | RubberDandelionOmics

Gene overview

TkA01G075780

Reference: TK1151 Chr: Chr01 Coordinates: 19389033-19389362 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

330 bp · TkA01G075780|TK1151|cDNA

ATGTCGGACAAAAAGATCCTAACTTACAACGACGTCATCCTCCTCGAATCCGACCTCACAATTCTAAAAAACCCTCATTTCCTCAACGACCGCATCATCGAATTCTACTTCTCTCACCTCACAACATCCCACCCCATCCTACTCGTCCCACCCTTCAATCACCTTCTGGATAATCAACTGTCCGGATACAGACACCTCCCAGACTTCTCCACCCCCCCTAACCTCCCGTCCAAAACCCTAATCCTCTTCCCGTCAACAAC...

CDS

Download CDS FASTA

330 bp · TkA01G075780|TK1151|CDS

ATGTCGGACAAAAAGATCCTAACTTACAACGACGTCATCCTCCTCGAATCCGACCTCACAATTCTAAAAAACCCTCATTTCCTCAACGACCGCATCATCGAATTCTACTTCTCTCACCTCACAACATCCCACCCCATCCTACTCGTCCCACCCTTCAATCACCTTCTGGATAATCAACTGTCCGGATACAGACACCTCCCAGACTTCTCCACCCCCCCTAACCTCCCGTCCAAAACCCTAATCCTCTTCCCGTCAACAAC...

Protein

Download Protein FASTA

109 aa · TkA01G075780|TK1151|PROTEIN

MSDKKILTYNDVILLESDLTILKNPHFLNDRIIEFYFSHLTTSHPILLVPPFNHLLDNQLSGYRHLPDFSTPPNLPSKTLILFPSTTTTTSHSQKAGSHWSLLAFERNQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G075780`
TK1151 ID	TkA01G075780
OH-1004 ID	LXL04_005211
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	72.900
Protein coverage (%)	TK1151 98.165 / OH-1004 47.982 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G075780

Location Chr01:19389033-19389362 (+)

Description Similar to NEDP1: NEDD8-specific protease 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g60190`	Processes the pre-form of the ubiquitin-like protein NEDD8/RUB1.	SUMO-conjugating and SUMO-deconjugating enzymes from Arabidopsis.2006 · DOI: 10.1104/pp.106.085415

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005211 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000338 protein deneddylation Biological Process

GO:0006508 proteolysis Biological Process

GO:0016579 protein deubiquitination Biological Process

GO:0016926 protein desumoylation Biological Process

GO:0043687 post-translational protein modification Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0008234 cysteine-type peptidase activity Molecular Function

GO:0016929 deSUMOylase activity Molecular Function

GO:0019784 deNEDDylase activity Molecular Function

KEGG gene cross-reference

ath:AT5G60190

ddi:DDB_G0278795

hsa:123228

mmu:71599

rno:315723

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.814

Rank 1 · TkA01G075780 · TK1151

Cytoplasm0.499

Rank 2 · TkA01G075780 · TK1151

Mitochondrion0.034

Rank 3 · TkA01G075780 · TK1151

Endoplasmic reticulum0.011

Rank 4 · TkA01G075780 · TK1151

Cell membrane0.010

Rank 5 · TkA01G075780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04813HNF-1A_C38-50 aa

PF04813HNF-1A_C67-96 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G075780	`PF04813`	HNF-1A_C	38	50	0.034	15.5
TkA01G075780	`PF04813`	HNF-1A_C	67	96	0.034	15.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LSS7`	Arabidopsis thaliana	sp\|Q9LSS7\|RUBP1_ARATH NEDD8-specific protease 1	43.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card