TkA01G075750 | RubberDandelionOmics

Gene overview

TkA01G075750

Reference: TK1151 Chr: Chr01 Coordinates: 19374499-19380761 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA No cDNA sequence available

cDNA

No cDNA sequence is available for this reference.

CDS

Download CDS FASTA

2460 bp · TkA01G075750|TK1151|CDS

ATGGAAATGCTAAAGAATTTACCGGAGATGGATCTGATGCGGTCGGAGAAGATGACGTTCGTCCAGTTAATCATCCCGGTTGAATCCGCTCACCGCGCCATCTCCTATCTTGGCGAACTCGGTCTACTCCAGTTCCGCGACTTAAATGAAGATAAAAGCCCATTTCAAAGAACATTTGTTAATCAGGTAAAAAGATGTGCTGAGATGTCAAGAAAACTTCGGTTTTTCAAAGATCAGATACACAAGGCCGGTTTATTATC...

Protein

Download Protein FASTA

819 aa · TkA01G075750|TK1151|PROTEIN

MEMLKNLPEMDLMRSEKMTFVQLIIPVESAHRAISYLGELGLLQFRDLNEDKSPFQRTFVNQVKRCAEMSRKLRFFKDQIHKAGLLSSALPTMQPDVDLEALEIQLADHEHELIEMNANSEKLQQTYNELLEFKMVLQKAGDFLLSGKSYETSDGRELDENVYSSDYPDSVSLLEQATQSGPSNSSGLRFISGIIPKSKVLLFERMLFRATRGNLLFNQATADDLIMDPVTSEMVEKTVFVVFFSGEQAKTKILKICEAF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G075750`
TK1151 ID	TkA01G075750
OH-1004 ID	LXL04_005212
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 92.647 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G075750

Location Chr01:19374499-19380761 (-)

Description Similar to VHA-a1: V-type proton ATPase subunit a1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g28520`	Essential component of the vacuolar proton pump (V-ATPase), a multimeric enzyme that catalyzes the translocation of protons across the membranes.	Reduced V-ATPase activity in the trans-Golgi network causes oxylipin-dependent hypocotyl growth Inhibition in Arabidopsis.2008 · DOI: 10.1105/tpc.108.058362
`At4g39080`	Essential component of the vacuolar proton pump (V-ATPase), a multimeric enzyme that catalyzes the translocation of protons across the membranes.	Arabidopsis V-ATPase activity at the tonoplast is required for efficient nutrient storage but not for sodium accumulation.2010 · DOI: 10.1073/pnas.0913035107
`At2g21410`	Essential component of the vacuolar proton pump (V-ATPase), a multimeric enzyme that catalyzes the translocation of protons across the membranes.	Arabidopsis V-ATPase activity at the tonoplast is required for efficient nutrient storage but not for sodium accumulation.2010 · DOI: 10.1073/pnas.0913035107

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005212 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006911 phagocytosis, engulfment Biological Process

GO:0007035 vacuolar acidification Biological Process

GO:0015986 proton motive force-driven ATP synthesis Biological Process

GO:0051453 regulation of intracellular pH Biological Process

GO:0070070 proton-transporting V-type ATPase complex assembly Biological Process

GO:1902600 proton transmembrane transport Biological Process

GO:2000012 regulation of auxin polar transport Biological Process

GO:0000220 vacuolar proton-transporting V-type ATPase, V0 domain Cellular Component

GO:0000325 plant-type vacuole Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005764 lysosome Cellular Component

KEGG gene cross-reference

ath:AT2G21410

ath:AT2G28520

ath:AT4G39080

ddi:DDB_G0291858

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.336

Rank 1 · TkA01G075750 · TK1151

Golgi apparatus0.312

Rank 2 · TkA01G075750 · TK1151

Cytoplasm0.238

Rank 3 · TkA01G075750 · TK1151

Lysosome / Vacuole0.181

Rank 4 · TkA01G075750 · TK1151

Cell membrane0.144

Rank 5 · TkA01G075750 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01496V_ATPase_I36-810 aa

PF11423Repressor_Mnt106-114 aa

PF11423Repressor_Mnt232-240 aa

PF11204DUF2985306-317 aa

PF11423Repressor_Mnt316-329 aa

PF11204DUF2985754-797 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G075750	`PF01496`	V_ATPase_I	36	810	8.5e-292	970.7
TkA01G075750	`PF11423`	Repressor_Mnt	106	114	4.5	7.9
TkA01G075750	`PF11423`	Repressor_Mnt	232	240	4.5	7.9
TkA01G075750	`PF11204`	DUF2985	306	317	0.047	14.5
TkA01G075750	`PF11423`	Repressor_Mnt	316	329	4.5	7.9
TkA01G075750	`PF11204`	DUF2985	754	797	0.047	14.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RWZ7`	Arabidopsis thaliana	sp\|Q8RWZ7\|VHAA1_ARATH V-type proton ATPase subunit a1	79.300%	Swiss-Prot	High
`Q8W4S4`	Arabidopsis thaliana	sp\|Q8W4S4\|VHAA3_ARATH V-type proton ATPase subunit a3	63.500%	Swiss-Prot	High
`Q9SJT7`	Arabidopsis thaliana	sp\|Q9SJT7\|VHAA2_ARATH V-type proton ATPase subunit a2	62.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card