TkA01G075440 | RubberDandelionOmics

Gene overview

TkA01G075440

Reference: TK1151 Chr: Chr01 Coordinates: 19294574-19296154 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

429 bp · TkA01G075440|TK1151|cDNA

ATGTTGAAGAAGAGGACCAGGAGCAGTGAAGATTCCGAGTTAAGCTTGGGTCGATTCCATCTCGATTTATTCTTCAAGTTCTTCAAATCCACCAACATCCTTTTGAGCGATGATTATGAAGCAAAGATATCGGATTTTGGTATGGCTAAGCTAATGCCTGAGGGTCAAGAAACTAATGTGACACAAGGGTATTTCGATCCTGTTGCTGTTTTTTTTGGGTGGTCGTTGTGGCAATTCTGTATTCCCTTTGCGACTGTTCT...

CDS

Download CDS FASTA

429 bp · TkA01G075440|TK1151|CDS

ATGTTGAAGAAGAGGACCAGGAGCAGTGAAGATTCCGAGTTAAGCTTGGGTCGATTCCATCTCGATTTATTCTTCAAGTTCTTCAAATCCACCAACATCCTTTTGAGCGATGATTATGAAGCAAAGATATCGGATTTTGGTATGGCTAAGCTAATGCCTGAGGGTCAAGAAACTAATGTGACACAAGGGTATTTCGATCCTGTTGCTGTTTTTTTTGGGTGGTCGTTGTGGCAATTCTGTATTCCCTTTGCGACTGTTCT...

Protein

Download Protein FASTA

142 aa · TkA01G075440|TK1151|PROTEIN

MLKKRTRSSEDSELSLGRFHLDLFFKFFKSTNILLSDDYEAKISDFGMAKLMPEGQETNVTQGYFDPVAVFFGWSLWQFCIPFATVLLSCSGLLFISAGSVPRVFMHQVVVVAVFPPRMLVRLPCSGVRFIPCCCSVLGLLF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G075440`
TK1151 ID	TkA01G075440
OH-1004 ID	LXL04_005215
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	92.200
Protein coverage (%)	TK1151 84.507 / OH-1004 85.906 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G075440

Location Chr01:19294574-19296154 (+)

Description Similar to PBL28: Probable serine/threonine-protein kinase PBL28

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g24030`	May be involved in plant defense signaling.	No verified direct reference in this release
`At2g26290`	May play a role in the signal transduction pathway of osmotic stress (Probable).	An Arabidopsis thaliana root-specific kinase homolog is induced by dehydration, ABA, and NaCl.1995 · DOI: 10.1046/j.1365-313x.1995.08010037.x
`At2g05940`	Serine/threonine-protein kinase involved in disease resistance.	xopAC-triggered immunity against Xanthomonas depends on Arabidopsis receptor-like cytoplasmic kinase genes PBL2 and RIPK.2013 · DOI: 10.1371/journal.pone.0073469 Pseudomonas syringae Effector AvrPphB Suppresses AvrB-Induced Activation of RPM1 but Not AvrRpm1-Induced Activation.2015 · DOI: 10.1094/mpmi-08-14-0248-r
`At5g01020`	May be involved in plant defense signaling.	No verified direct reference in this release
`At5g35580`	Involved in defense responses.	PBL13 Is a Serine/Threonine Protein Kinase That Negatively Regulates Arabidopsis Immune Responses.2015 · DOI: 10.1104/pp.15.01391

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005215 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002238 response to molecule of fungal origin Biological Process

GO:0006468 protein phosphorylation Biological Process

GO:0006952 defense response Biological Process

GO:0032491 detection of molecule of fungal origin Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0050777 negative regulation of immune response Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0062207 regulation of pattern recognition receptor signaling pathway Biological Process

GO:1903428 positive regulation of reactive oxygen species biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G24030

ath:AT2G05940

ath:AT2G26290

ath:AT5G01020

ath:AT5G35580

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.426

Rank 1 · TkA01G075440 · TK1151

Nucleus0.358

Rank 2 · TkA01G075440 · TK1151

Mitochondrion0.144

Rank 3 · TkA01G075440 · TK1151

Endoplasmic reticulum0.140

Rank 4 · TkA01G075440 · TK1151

Cell membrane0.102

Rank 5 · TkA01G075440 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase28-64 aa

PF07714PK_Tyr_Ser-Thr30-63 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G075440	`PF00069`	Pkinase	28	64	4e-05	23.9
TkA01G075440	`PF07714`	PK_Tyr_Ser-Thr	30	63	0.0014	18.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84M95`	Arabidopsis thaliana	sp\|Q84M95\|PBL28_ARATH Probable serine/threonine-protein kinase PBL28	65.200%	Swiss-Prot	Low
`O64842`	Arabidopsis thaliana	sp\|O64842\|PBL12_ARATH Probable serine/threonine-protein kinase PBL12	47.400%	Swiss-Prot	Low
`Q9ZUF4`	Arabidopsis thaliana	sp\|Q9ZUF4\|RIPK_ARATH Serine/threonine-protein kinase RIPK	47.400%	Swiss-Prot	Low
`Q8GXZ3`	Arabidopsis thaliana	sp\|Q8GXZ3\|PBL8_ARATH Probable serine/threonine-protein kinase PBL8	47.400%	Swiss-Prot	Low
`F4JZW1`	Arabidopsis thaliana	sp\|F4JZW1\|PBL13_ARATH Serine/threonine-protein kinase PBL13	45.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card