TkA01G073350 | RubberDandelionOmics

Gene overview

TkA01G073350

Reference: TK1151 Chr: Chr01 Coordinates: 18799846-18804024 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2507 bp · TkA01G073350|TK1151|cDNA

CTCCGAACTACGGCCTGTCCCGTTGTTTAAACTTTTAAGGTTTAAACCCTCAAAAGCCCTAAAAAGCATACACCCTCATAACTTTCACATCACATCTCCGGCGAAATGCCAGGCCTTCTTACAGGTTCCGGTGATTCTTCCGCCCTCGTTCCCTTTTCTCCGGAAGCCAACACTCCTGCAGTATATCCTCTCCACCACGGCCTTCAACCCCCAATCGCTCCTCGTCTCTCAATTTCATGGTCAAGTGGTAACTCGATTCG...

CDS

Download CDS FASTA

2166 bp · TkA01G073350|TK1151|CDS

ATGCCAGGCCTTCTTACAGGTTCCGGTGATTCTTCCGCCCTCGTTCCCTTTTCTCCGGAAGCCAACACTCCTGCAGTATATCCTCTCCACCACGGCCTTCAACCCCCAATCGCTCCTCGTCTCTCAATTTCATGGTCAAGTGGTAACTCGATTCGCGTGTCGGTCTTCCGGTCACCTGAGACTACTAAAACCACCGATGGTGAAGCTGAAGTTGGCGGGAAAGTAGTTGAGTTAAAGGTAAGTGGAGAAGATGTTGTTAG...

Protein

Download Protein FASTA

721 aa · TkA01G073350|TK1151|PROTEIN

MPGLLTGSGDSSALVPFSPEANTPAVYPLHHGLQPPIAPRLSISWSSGNSIRVSVFRSPETTKTTDGEAEVGGKVVELKVSGEDVVSEVNDAARWRRIVYGSVSPFAHLQNKKNAMAALSELRHSAPSEVEWSKYVLEYSKEINSLLGNRKSSPSPLIEDPKTVLKNDEEPSCLKAAWELLEIFYANKQSHSWIPEQLVDWLTDYDSLFTGQVPAVHSRLVEFQTKLINIQTVENEAAYWQAISSALSIGWLDISVKLLR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G073350`
TK1151 ID	TkA01G073350
OH-1004 ID	LXL04_005250
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G073350

Location Chr01:18799846-18804024 (-)

Description Similar to NUP85: Nuclear pore complex protein NUP85

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g32910`	Functions as a component of the nuclear pore complex (NPC).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005250 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006406 mRNA export from nucleus Biological Process

GO:0006606 protein import into nucleus Biological Process

GO:0006913 nucleocytoplasmic transport Biological Process

GO:0006935 chemotaxis Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0019221 cytokine-mediated signaling pathway Biological Process

GO:0030032 lamellipodium assembly Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0000776 kinetochore Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005635 nuclear envelope Cellular Component

GO:0005654 nucleoplasm Cellular Component

KEGG gene cross-reference

ath:AT4G32910

dre:445231

hsa:79902

mmu:445007

rno:287830

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.848

Rank 1 · TkA01G073350 · TK1151

Cytoplasm0.147

Rank 2 · TkA01G073350 · TK1151

Cell membrane0.043

Rank 3 · TkA01G073350 · TK1151

Endoplasmic reticulum0.027

Rank 4 · TkA01G073350 · TK1151

Golgi apparatus0.024

Rank 5 · TkA01G073350 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27904Lepto_Lipo_YY_C79-135 aa

PF07575Nucleopor_Nup8588-683 aa

PF27904Lepto_Lipo_YY_C321-366 aa

PF27612WHD_RepA_N487-533 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G073350	`PF27904`	Lepto_Lipo_YY_C	79	135	0.03	15.4
TkA01G073350	`PF07575`	Nucleopor_Nup85	88	683	1.1e-129	434.4
TkA01G073350	`PF27904`	Lepto_Lipo_YY_C	321	366	0.03	15.4
TkA01G073350	`PF27612`	WHD_RepA_N	487	533	0.12	12.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RXH2`	Arabidopsis thaliana	sp\|Q8RXH2\|NUP85_ARATH Nuclear pore complex protein NUP85	62.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card