TkA01G069750 | RubberDandelionOmics

Gene overview

TkA01G069750

Reference: TK1151 Chr: Chr01 Coordinates: 17856127-17858078 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

474 bp · TkA01G069750|TK1151|cDNA

ATGGCTATTGATGGAGGATTAGAAACGGGAAAAGGGATTGGATTTTGGAGGAACTTTACGGACAGCATGTACCACACTGCCATGGAAGCACTTGTAGTAGGTTCTTCTCTATCACAAAACGATACAAGGCATGCTTTCTATCAAAAACTAAATGAAGTTGTTGTCACCATCTTTGCTAAAGTTATAAACTGGAAATCCCTAGAATACCCCCAGAAAACGGGTGTTCTTCATCAAGAATATAGACCTTTGAACCCATCTGT...

CDS

Download CDS FASTA

474 bp · TkA01G069750|TK1151|CDS

ATGGCTATTGATGGAGGATTAGAAACGGGAAAAGGGATTGGATTTTGGAGGAACTTTACGGACAGCATGTACCACACTGCCATGGAAGCACTTGTAGTAGGTTCTTCTCTATCACAAAACGATACAAGGCATGCTTTCTATCAAAAACTAAATGAAGTTGTTGTCACCATCTTTGCTAAAGTTATAAACTGGAAATCCCTAGAATACCCCCAGAAAACGGGTGTTCTTCATCAAGAATATAGACCTTTGAACCCATCTGT...

Protein

Download Protein FASTA

157 aa · TkA01G069750|TK1151|PROTEIN

MAIDGGLETGKGIGFWRNFTDSMYHTAMEALVVGSSLSQNDTRHAFYQKLNEVVVTIFAKVINWKSLEYPQKTGVLHQEYRPLNPSVRQRVKKEEKEEKLDEDAGVNEMFGGIYKNADEDMRRAMNKSFAESNVTVLSTSWKEVGKKKINLSRPDRR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G069750`
TK1151 ID	TkA01G069750
OH-1004 ID	LXL04_005515
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	49.600
Protein coverage (%)	TK1151 84.076 / OH-1004 71.084 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G069750

Location Chr01:17856127-17858078 (+)

Description Similar to SGT1B: Protein SGT1 homolog B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g11260`	Involved in plant innate immunity.	Regulatory role of SGT1 in early R gene-mediated plant defenses.2002 · DOI: 10.1126/science.1067747 Arabidopsis SGT1b is required for defense signaling conferred by several downy mildew resistance genes.2002 · DOI: 10.1105/tpc.001123 Arabidopsis SGT1b is required for SCF(TIR1)-mediated auxin response.2003 · DOI: 10.1105/tpc.010884 Antagonistic control of disease resistance protein stability in the plant immune system.2005 · DOI: 10.1126/science.1109977 Role of SGT1 in resistance protein accumulation in plant immunity.2006 · DOI: 10.1038/sj.emboj.7601084 Interaction between SGT1 and cytosolic/nuclear HSC70 chaperones regulates Arabidopsis immune responses.2007 · DOI: 10.1105/tpc.107.051896 Enhanced defense responses in Arabidopsis induced by the cell wall protein fractions from Pythium oligandrum require SGT1, RAR1, NPR1 and JAR1.2009 · DOI: 10.1093/pcp/pcp044 SGT1 contributes to coronatine signaling and Pseudomonas syringae pv. tomato disease symptom development in tomato and Arabidopsis.2011 · DOI: 10.1111/j.1469-8137.2010.03470.x
`At4g23570`	Functions in R gene-mediated resistance, but participates in a lower extent than SGT1B to RPP5-mediated resistance.	Role of SGT1 in resistance protein accumulation in plant immunity.2006 · DOI: 10.1038/sj.emboj.7601084

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0624500`	May participate in basal resistance to bacterial blight in rice.	OsRAR1 and OsSGT1 physically interact and function in rice basal disease resistance.2008 · DOI: 10.1094/mpmi-21-3-0294

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005515 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0006952 defense response Biological Process

GO:0007051 spindle organization Biological Process

GO:0009408 response to heat Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009867 jasmonic acid mediated signaling pathway Biological Process

GO:0010187 negative regulation of seed germination Biological Process

GO:0014841 skeletal muscle satellite cell proliferation Biological Process

GO:0030163 protein catabolic process Biological Process

GO:0031647 regulation of protein stability Biological Process

GO:0042742 defense response to bacterium Biological Process

KEGG gene cross-reference

ath:AT4G11260

ath:AT4G23570

dosa:Os01g0624500

mmu:67955

zma:103636097

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.519

Rank 1 · TkA01G069750 · TK1151

Nucleus0.234

Rank 2 · TkA01G069750 · TK1151

Mitochondrion0.143

Rank 3 · TkA01G069750 · TK1151

Peroxisome0.123

Rank 4 · TkA01G069750 · TK1151

Cell membrane0.070

Rank 5 · TkA01G069750 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05002SGS41-50 aa

PF05002SGS88-155 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G069750	`PF05002`	SGS	41	50	2e-23	83.0
TkA01G069750	`PF05002`	SGS	88	155	2e-23	83.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SUT5`	Arabidopsis thaliana	sp\|Q9SUT5\|SGT1B_ARATH Protein SGT1 homolog B	52.200%	Swiss-Prot	Medium
`Q9SUR9`	Arabidopsis thaliana	sp\|Q9SUR9\|SGT1A_ARATH Protein SGT1 homolog A	45.700%	Swiss-Prot	Medium
`Q0JL44`	Oryza sativa subsp. japonica	sp\|Q0JL44\|SGT1_ORYSJ Protein SGT1 homolog	48.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card