TkA01G062030 | RubberDandelionOmics

Gene overview

TkA01G062030

Reference: TK1151 Chr: Chr01 Coordinates: 15976054-15978278 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1109 bp · TkA01G062030|TK1151|cDNA

TCTGCGTCTGTGGTCTCCGACGATTCCAAAGAAATTCTCGTCGTCTCTCTCTCGTCTCTCTCTCTCTCTCTCTCTCTCCACAACAGTTATCGAAATTGATCGGGGAGGAACATAGTTTCCTCACTTCTTAACATTACCATGGATACTCCAAGCTCCTGGGATTCCTTGCGAAAACAGGCAAGGAATCTTGAAGCAGAAATGGGATGATCAAATGCATTTGTACCGTAAACTTGTGTCCACAAAAGTTGATGATGGCACTG...

CDS

Download CDS FASTA

453 bp · TkA01G062030|TK1151|CDS

ATGCATTTGTACCGTAAACTTGTGTCCACAAAAGTTGATGATGGCACTGAGAGTAACCTTGGATCAAGTATAGAACAGCTACTTAAACAACTACACCAAGTAATCTCCCAAATGCAAGCTTGGGTGTCATCAGGTGGTTCAGAGATCTTTTCTCATACATTGACACGTCATCAAGAAATTCATCATGATCTCACTCAGGAGTTTAATCGGCTTCGTTCGAGTCTTAGAGCTAAAAGAGAGCATGCATCATTGCTTGAAGA...

Protein

Download Protein FASTA

150 aa · TkA01G062030|TK1151|PROTEIN

MHLYRKLVSTKVDDGTESNLGSSIEQLLKQLHQVISQMQAWVSSGGSEIFSHTLTRHQEIHHDLTQEFNRLRSSLRAKREHASLLEDFREFDRARLDIEEGGGGEQQSLLKERASLMRNTGQVCSPLSSYIFIFRNLVIFSFHFFFRWMV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G062030`
TK1151 ID	TkA01G062030
OH-1004 ID	LXL04_005354
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	96.900
Protein coverage (%)	TK1151 85.333 / OH-1004 57.919 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G062030

Location Chr01:15976054-15978278 (+)

Description Similar to GOS11: Golgi SNAP receptor complex member 1-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g15880`	Involved in transport from the ER to the Golgi apparatus as well as in intra-Golgi transport.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005354 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process

GO:0006891 intra-Golgi vesicle-mediated transport Biological Process

GO:0006906 vesicle fusion Biological Process

GO:0015031 protein transport Biological Process

GO:0042147 retrograde transport, endosome to Golgi Biological Process

GO:0048219 inter-Golgi cisterna vesicle-mediated transport Biological Process

GO:0000138 Golgi trans cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0000325 plant-type vacuole Cellular Component

GO:0005768 endosome Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

KEGG gene cross-reference

ath:AT1G15880

ath:AT2G45200

bta:511030

cge:100689312

hsa:9527

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.509

Rank 1 · TkA01G062030 · TK1151

Nucleus0.257

Rank 2 · TkA01G062030 · TK1151

Golgi apparatus0.222

Rank 3 · TkA01G062030 · TK1151

Endoplasmic reticulum0.169

Rank 4 · TkA01G062030 · TK1151

Lysosome / Vacuole0.081

Rank 5 · TkA01G062030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10392COG5_N7-75 aa

PF27017GOSR1_N18-88 aa

PF18476PIN_819-82 aa

PF19793DUF627729-76 aa

PF27017GOSR1_N110-119 aa

PF19793DUF6277114-125 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G062030	`PF10392`	COG5_N	7	75	0.027	15.4
TkA01G062030	`PF27017`	GOSR1_N	18	88	1e-11	45.9
TkA01G062030	`PF18476`	PIN_8	19	82	0.15	12.6
TkA01G062030	`PF19793`	DUF6277	29	76	0.2	12.6
TkA01G062030	`PF27017`	GOSR1_N	110	119	1e-11	45.9
TkA01G062030	`PF19793`	DUF6277	114	125	0.2	12.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LMP7`	Arabidopsis thaliana	sp\|Q9LMP7\|GOS11_ARATH Golgi SNAP receptor complex member 1-1	66.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card