TkA01G060600 | RubberDandelionOmics

Gene overview

TkA01G060600

Reference: TK1151 Chr: Chr01 Coordinates: 15613277-15613675 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

399 bp · TkA01G060600|TK1151|cDNA

TCGCATTTGAAGCCCGGTGGGACGGTCTTGCCACATGCACTCACCAACACGCTTAGTGAAATCGGGACATTAAGGTTAATTCCCAACACATTAGCCTTAATGGCGGTACAAAGACAGGCGGCAACTTCCAAATCAACCAAACCCTCAAGCAACGCACAACATTTGCTAGATTCCTGGGACCCAATAACAACATTCACCAACCCTAAAACGTCGGCACACACTCCAAGCTTCAAGGTGTCTCTAGGGCAAGAGGGGTTTGC...

CDS

Download CDS FASTA

399 bp · TkA01G060600|TK1151|CDS

TCGCATTTGAAGCCCGGTGGGACGGTCTTGCCACATGCACTCACCAACACGCTTAGTGAAATCGGGACATTAAGGTTAATTCCCAACACATTAGCCTTAATGGCGGTACAAAGACAGGCGGCAACTTCCAAATCAACCAAACCCTCAAGCAACGCACAACATTTGCTAGATTCCTGGGACCCAATAACAACATTCACCAACCCTAAAACGTCGGCACACACTCCAAGCTTCAAGGTGTCTCTAGGGCAAGAGGGGTTTGC...

Protein

Download Protein FASTA

132 aa · TkA01G060600|TK1151|PROTEIN

SHLKPGGTVLPHALTNTLSEIGTLRLIPNTLALMAVQRQAATSKSTKPSSNAQHLLDSWDPITTFTNPKTSAHTPSFKVSLGQEGFAGGPLGGGTGFVGVHVPQASENETLQMMRKKMKILHASEVLAMARE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G060600`
TK1151 ID	TkA01G060600
OH-1004 ID	LXL04_005322
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.300
Protein coverage (%)	TK1151 91.667 / OH-1004 44.322 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G060600`
Location	Chr01:15613277-15613675 (-)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_005322` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009704 de-etiolation Biological Process GO:0045036 protein targeting to chloroplast Biological Process GO:1904216 positive regulation of protein import into chloroplast stroma Biological Process GO:0005737 cytoplasm Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009507 chloroplast Cellular Component GO:0009536 plastid Cellular Component GO:0009707 chloroplast outer membrane Cellular Component GO:0009941 chloroplast envelope Cellular Component GO:0010006 Toc complex Cellular Component GO:0004672 protein kinase activity Molecular Function GO:0004674 protein serine/threonine kinase activity Molecular Function
KEGG gene cross-reference	ath:AT4G32250 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.519

Rank 1 · TkA01G060600 · TK1151

Cytoplasm0.350

Rank 2 · TkA01G060600 · TK1151

Mitochondrion0.142

Rank 3 · TkA01G060600 · TK1151

Cell membrane0.042

Rank 4 · TkA01G060600 · TK1151

Endoplasmic reticulum0.034

Rank 5 · TkA01G060600 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02812ELFV_dehydrog_N87-122 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G060600	`PF02812`	ELFV_dehydrog_N	87	122	0.17	12.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card