TkA01G056110 | RubberDandelionOmics

Gene overview

TkA01G056110

Reference: TK1151 Chr: Chr01 Coordinates: 14505006-14507123 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1888 bp · TkA01G056110|TK1151|cDNA

CGACAACATACTTATCATCAGTTGACAAATGCAGCTTTTTAATCTCAAGATTCAAGATTGCATTGCAGCCCGATTGGTCATGTTTCCTTCTAATCAATCCAATGTTGGTAAACCACCAGATGATGATCCTTCATCTAAGCTACTGGAAGTCAATGCCTCTAATATCACCAAAACTGAAATAACCACTAACCTCGAAACAGATCACCAGAAACCTATTCCCAGTGACGACGTTGGAGATTTAGATAGCTTTTTTGTCGATT...

CDS

Download CDS FASTA

1668 bp · TkA01G056110|TK1151|CDS

ATGCAGCTTTTTAATCTCAAGATTCAAGATTGCATTGCAGCCCGATTGGTCATGTTTCCTTCTAATCAATCCAATGTTGGTAAACCACCAGATGATGATCCTTCATCTAAGCTACTGGAAGTCAATGCCTCTAATATCACCAAAACTGAAATAACCACTAACCTCGAAACAGATCACCAGAAACCTATTCCCAGTGACGACGTTGGAGATTTAGATAGCTTTTTTGTCGATTTAGCATCTCCACCTTTTCAACGTTTGGT...

Protein

Download Protein FASTA

555 aa · TkA01G056110|TK1151|PROTEIN

MQLFNLKIQDCIAARLVMFPSNQSNVGKPPDDDPSSKLLEVNASNITKTEITTNLETDHQKPIPSDDVGDLDSFFVDLASPPFQRLVKGTHDFQSNNYQKGSPLVSVGKHMDFASILLKANAEKSFVKGPDETNQNLSNNARIRLAGQLFIETFSSKYDEISELSHPSYSGLSDDEAKDIKLLVTLLASAEKTGQRQFDRATKLIESCNTTSSPEGNLIERLVYYFSAAIREKINREMGRSAHDGLENMQMFDLKEALMS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G056110`
TK1151 ID	TkA01G056110
OH-1004 ID	LXL04_005393
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 97.297 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G056110

Location Chr01:14505006-14507123 (-)

Description Similar to RGL2: DELLA protein RGL2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g63100`	Probable transcription factor involved in plant development.	No verified direct reference in this release
`At5g41920`	Probable transcription factor involved in plant development.	No verified direct reference in this release
`At3g50650`	Probable transcription factor involved in plant development (Probable).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0127800`	Probable transcription factor that acts as a positive regulator of brassinosteroid (BR) signaling.	SMALL ORGAN SIZE 1 and SMALL ORGAN SIZE 2/DWARF AND LOW-TILLERING Form a Complex to Integrate Auxin and Brassinosteroid Signaling in Rice.2017 · DOI: 10.1016/j.molp.2016.12.013

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005393 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0006952 defense response Biological Process

GO:0009409 response to cold Biological Process

GO:0009610 response to symbiotic fungus Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0009908 flower development Biological Process

GO:0009938 negative regulation of gibberellic acid mediated signaling pathway Biological Process

GO:0010029 regulation of seed germination Biological Process

KEGG gene cross-reference

ath:AT2G01570

ath:AT3G03450

mtr:25489240

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.533

Rank 1 · TkA01G056110 · TK1151

Cytoplasm0.493

Rank 2 · TkA01G056110 · TK1151

Cell membrane0.063

Rank 3 · TkA01G056110 · TK1151

Endoplasmic reticulum0.045

Rank 4 · TkA01G056110 · TK1151

Plastid0.034

Rank 5 · TkA01G056110 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29127SUCH1_C176-250 aa

PF03514GRAS185-552 aa

PF29127SUCH1_C290-333 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G056110	`PF29127`	SUCH1_C	176	250	0.0072	16.7
TkA01G056110	`PF03514`	GRAS	185	552	5.2e-77	260.0
TkA01G056110	`PF29127`	SUCH1_C	290	333	0.0072	16.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9CAN3`	Arabidopsis thaliana	sp\|Q9CAN3\|SCL28_ARATH Scarecrow-like protein 28	26.400%	Swiss-Prot	Low
`Q9FHZ1`	Arabidopsis thaliana	sp\|Q9FHZ1\|SCL23_ARATH Scarecrow-like protein 23	27.800%	Swiss-Prot	Low
`Q9SCR0`	Arabidopsis thaliana	sp\|Q9SCR0\|SCL7_ARATH Scarecrow-like protein 7	26.600%	Swiss-Prot	Low
`Q9LWU9`	Oryza sativa subsp. japonica	sp\|Q9LWU9\|DLT_ORYSJ Protein DWARF AND LOW-TILLERING	26.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card