TkA01G049230 | RubberDandelionOmics

Gene overview

TkA01G049230

Reference: TK1151 Chr: Chr01 Coordinates: 12735229-12737374 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1298 bp · TkA01G049230|TK1151|cDNA

AATGGAAGAAAGGGGCGGGTTGTTTGCATTGCACCCAAGCAAGGTTTGGGCTCGGAGTTAGGCCTCATTTTGTATGAGCGGACAAAAACCAACCACCTTTCACTTTCACCCTCCCTTTTGCCTACAAGTACCCTCGCATTCATCGCCGCTTCCATTTTCCACCACCTCGCCCTCAAACTGGCGACTTATAATCACGAAACCTCTCTCCTTCGTGAAATCAAACCTAAAAATCGAAGAATTATGGGCGCCGGAGGACCTGT...

CDS

Download CDS FASTA

918 bp · TkA01G049230|TK1151|CDS

AATGGAAGAAAGGGGCGGGTTGTTTGCATTGCACCCAAGCAAGGTTTGGGCTCGGAGTTAGGCCTCATTTTGTATGAGCGGACAAAAACCAACCACCTTTCACTTTCACCCTCCCTTTTGCCTACAAGTACCCTCGCATTCATCGCCGCTTCCATTTTCCACCACCTCGCCCTCAAACTGGCGACTTATAATCACGAAACCTCTCTCCTTCGTGAAATCAAACCTAAAAATCGAAGAATTATGGGCGCCGGAGGACCTGT...

Protein

Download Protein FASTA

305 aa · TkA01G049230|TK1151|PROTEIN

NGRKGRVVCIAPKQGLGSELGLILYERTKTNHLSLSPSLLPTSTLAFIAASIFHHLALKLATYNHETSLLREIKPKNRRIMGAGGPVEEENRWPPWLKPLLRESFFVQCKLHADSHKSECNMYCLDCMNGPLCSICLNHHEDHRAIQIRRSSYHDVIRVSEIQKFLDIASVQTYVINSAKVVFLNERPQPRPGKGVTNTCEVCERSLLDSFRFCSLGCKIVGTSKNFERKRKVSPEKKHLLMGVSDSDDSYSSGGNLRQL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G049230`
TK1151 ID	TkA01G049230
OH-1004 ID	LXL04_005442
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.700
Protein coverage (%)	TK1151 95.082 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G049230`
Location	Chr01:12735229-12737374 (-)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_005442` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0010078 maintenance of root meristem identity Biological Process GO:0043434 response to peptide hormone Biological Process GO:2000280 regulation of root development Biological Process GO:2000377 regulation of reactive oxygen species metabolic process Biological Process GO:0005634 nucleus Cellular Component GO:0008270 zinc ion binding Molecular Function
KEGG gene cross-reference	ath:AT2G12646 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.803

Rank 1 · TkA01G049230 · TK1151

Cytoplasm0.204

Rank 2 · TkA01G049230 · TK1151

Cell membrane0.067

Rank 3 · TkA01G049230 · TK1151

Endoplasmic reticulum0.046

Rank 4 · TkA01G049230 · TK1151

Lysosome / Vacuole0.017

Rank 5 · TkA01G049230 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04640PLATZ123-127 aa

PF04640PLATZ149-220 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G049230	`PF04640`	PLATZ	123	127	2.8e-31	108.7
TkA01G049230	`PF04640`	PLATZ	149	220	2.8e-31	108.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card