TkA01G048930 | RubberDandelionOmics

Gene overview

TkA01G048930

Reference: TK1151 Chr: Chr01 Coordinates: 12636524-12638385 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1725 bp · TkA01G048930|TK1151|cDNA

CTAAAAAAGCCTTTAACACCACCGCGGTAGAGATCATTGACCATATGTGCAAGGTTCTTCACTACCTCTGTCGTTCGTCTTCTAACTTTTCAAAACCCTCGACGCAAATCACAAAGTCTCTACCACAGATCTCTATATGTTCTCAACTACCATAGGGTTTTTAAATTCGATCTATGGCGCTCCAAAACCCTATTCAAATCCCCACATTAGTCGCCATGGAACCTGGTAAGACTAACAATGGTGCCGCGGTCGCTGCAGAC...

CDS

Download CDS FASTA

1125 bp · TkA01G048930|TK1151|CDS

ATGGCGCTCCAAAACCCTATTCAAATCCCCACATTAGTCGCCATGGAACCTGGTAAGACTAACAATGGTGCCGCGGTCGCTGCAGACGGTGGTGCTCCTGCTGCTCTACCCTCCTCCGCCCCATCTCCATCTCCAGCTCCTTCCCCGGCTCCTATGCCAACCGTGAATTCTCCCCCGCCGTTCTTGGTAAAGACATACGATATGGTGGATGATCCTTCTACAGATATGATTGTTTCCTGGAGTGCTACCAATAACAGCTT...

Protein

Download Protein FASTA

374 aa · TkA01G048930|TK1151|PROTEIN

MALQNPIQIPTLVAMEPGKTNNGAAVAADGGAPAALPSSAPSPSPAPSPAPMPTVNSPPPFLVKTYDMVDDPSTDMIVSWSATNNSFIVRDPPEFAKDLLPKYFKHNNFSSFVRQLNTYGFRKVDPDKWEFANEGFLRGQKHLLKTIIRRKPGSLHNHNHQPPTTQASSVSCVEVGNFGLEEEVEWLKRDKNVLMQELVRLRQQQQSTDNQMQSMAQRLQGMEQRQQQMMSFLAKAVNSPGFLANFVQQNESAKFITEEN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G048930`
TK1151 ID	TkA01G048930
OH-1004 ID	LXL04_005450
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G048930

Location Chr01:12636524-12638385 (-)

Description Similar to HSF8: Heat shock factor protein HSF8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g17750`	Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE).	No verified direct reference in this release
`At1g32330`	Transcriptional regulator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0854500`	Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005450 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009408 response to heat Biological Process

GO:0034605 cellular response to heat Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT1G32330

ath:AT4G17750

dosa:Os03g0854500

sly:101263626

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.931

Rank 1 · TkA01G048930 · TK1151

Cytoplasm0.192

Rank 2 · TkA01G048930 · TK1151

Cell membrane0.022

Rank 3 · TkA01G048930 · TK1151

Mitochondrion0.020

Rank 4 · TkA01G048930 · TK1151

Endoplasmic reticulum0.013

Rank 5 · TkA01G048930 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00447HSF_DNA-bind61-150 aa

PF12325TMF_TATA_bd166-233 aa

PF15744UPF0492167-276 aa

PF20994CENPU177-254 aa

PF25078DUF7801177-230 aa

PF17675APG6_N180-230 aa

PF30810AFAP_C181-228 aa

PF10168Nup88181-238 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G048930	`PF00447`	HSF_DNA-bind	61	150	9.9e-30	103.7
TkA01G048930	`PF12325`	TMF_TATA_bd	166	233	0.0027	18.5
TkA01G048930	`PF15744`	UPF0492	167	276	0.069	13.0
TkA01G048930	`PF20994`	CENPU	177	254	0.027	14.8
TkA01G048930	`PF25078`	DUF7801	177	230	0.069	14.1
TkA01G048930	`PF17675`	APG6_N	180	230	0.0075	17.4
TkA01G048930	`PF30810`	AFAP_C	181	228	0.054	14.4
TkA01G048930	`PF10168`	Nup88	181	238	1.0	7.8
TkA01G048930	`PF29577`	FAM161_N	195	217	0.68	10.3
TkA01G048930	`PF06295`	ZapG-like	199	270	0.1	13.4
TkA01G048930	`PF29577`	FAM161_N	217	238	0.68	10.3
TkA01G048930	`PF00447`	HSF_DNA-bind	228	228	9.9e-30	103.7
TkA01G048930	`PF17675`	APG6_N	249	266	0.0075	17.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P41151`	Arabidopsis thaliana	sp\|P41151\|HFA1A_ARATH Heat stress transcription factor A-1a	62.500%	Swiss-Prot	Medium
`Q9LQM7`	Arabidopsis thaliana	sp\|Q9LQM7\|HFA1D_ARATH Heat stress transcription factor A-1d	73.100%	Swiss-Prot	Medium
`Q84T61`	Oryza sativa subsp. japonica	sp\|Q84T61\|HSFA1_ORYSJ Heat stress transcription factor A-1	66.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card