TkA01G048910 | RubberDandelionOmics

Gene overview

TkA01G048910

Reference: TK1151 Chr: Chr01 Coordinates: 12626255-12630770 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2542 bp · TkA01G048910|TK1151|cDNA

TAGAAATTGGATCTTGAAGATATTCTATTTAAATATTAACGACTTAACGTGTTTAGTCTCACATATGGGACAAGACTTGGAGCATGATCTCTCTCTCATGGCCATCCCACATGATCTTTAAGCATATATTTTCCTAGACAGGAAGAAGAAAGATGAGTTGTACAATACATACAGAGCTCCGTACAAGTAAATAATGCATCACAACTAGTATACAAGTACCATTATTCATGTATATCAGTAGAGTACTGTTGGAAATATGT...

CDS

Download CDS FASTA

1194 bp · TkA01G048910|TK1151|CDS

ATGGGTTGTGTAATTTCTCATCTGAGTGCGAAATTCGCCTTCTTTCCTCCGTCTCCGCCGACCTACCAGATAACGAAACGAGACGACGGGAAGCTAACGGCGGTGTACACATCCTCCTCCTTGCCGCTGACATCAGCCGTCGGAGTCGTTGACGACGGCGGATGTGGGTCTTCGTTTGATGTGTTGTCGTTACGCACTAGAAGAGGGAACAAGATTGTAGCTTTTTATCTGAAGAATCCATATGCGAAGCTGACTTTGCT...

Protein

Download Protein FASTA

397 aa · TkA01G048910|TK1151|PROTEIN

MGCVISHLSAKFAFFPPSPPTYQITKRDDGKLTAVYTSSSLPLTSAVGVVDDGGCGSSFDVLSLRTRRGNKIVAFYLKNPYAKLTLLYSHGNAADLGQLFDLFVQLKANLRVNLMGYDYSGYGASTGKPSELNTYADIEAVYECLQTEYGVSQEDLILYGQSVGSGPTLHLASRLPRLRGVVLHSAILSGLRVVCHVNCTFCFDIYKNVNKIRKVKCPTLVIHGTEDDVVSWLHGNRLWKMAKDPYEPLWIKGGGHCNLE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G048910`
TK1151 ID	TkA01G048910
OH-1004 ID	LXL04_005452
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G048910`
Location	Chr01:12626255-12630770 (+)
Description	Similar to abhd17c: Alpha/beta hydrolase domain-containing protein 17C
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_005452` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0002084 protein depalmitoylation Biological Process GO:1902473 regulation of protein localization to synapse Biological Process GO:1902817 negative regulation of protein localization to microtubule Biological Process GO:1905668 positive regulation of protein localization to endosome Biological Process GO:0005886 plasma membrane Cellular Component GO:0010008 endosome membrane Cellular Component GO:0016020 membrane Cellular Component GO:0055038 recycling endosome membrane Cellular Component GO:0008474 palmitoyl-(protein) hydrolase activity Molecular Function
KEGG gene cross-reference	dre:393126 gga:415479 gga:427252 hsa:51104 rno:309399 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.515

Rank 1 · TkA01G048910 · TK1151

Cytoplasm0.212

Rank 2 · TkA01G048910 · TK1151

Endoplasmic reticulum0.161

Rank 3 · TkA01G048910 · TK1151

Lysosome / Vacuole0.110

Rank 4 · TkA01G048910 · TK1151

Nucleus0.110

Rank 5 · TkA01G048910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12146Hydrolase_483-188 aa

PF20408Abhydrolase_1185-256 aa

PF00561Abhydrolase_186-186 aa

PF12697Abhydrolase_690-186 aa

PF02129Peptidase_S15117-191 aa

PF00326Peptidase_S9133-173 aa

PF20434BD-FAE147-165 aa

PF02230Abhydrolase_2148-243 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G048910	`PF12146`	Hydrolase_4	83	188	3.7e-11	43.5
TkA01G048910	`PF20408`	Abhydrolase_11	85	256	0.12	12.8
TkA01G048910	`PF00561`	Abhydrolase_1	86	186	2.4e-08	34.7
TkA01G048910	`PF12697`	Abhydrolase_6	90	186	1.7e-06	29.6
TkA01G048910	`PF02129`	Peptidase_S15	117	191	0.014	15.8
TkA01G048910	`PF00326`	Peptidase_S9	133	173	9.5e-05	22.7
TkA01G048910	`PF20434`	BD-FAE	147	165	0.15	12.2
TkA01G048910	`PF02230`	Abhydrolase_2	148	243	0.061	13.9
TkA01G048910	`PF03959`	FSH1	174	256	0.012	16.0
TkA01G048910	`PF12695`	Abhydrolase_5	197	262	0.15	12.6
TkA01G048910	`PF00326`	Peptidase_S9	206	256	9.5e-05	22.7
TkA01G048910	`PF12697`	Abhydrolase_6	208	260	1.7e-06	29.6
TkA01G048910	`PF20434`	BD-FAE	208	238	0.15	12.2
TkA01G048910	`PF02129`	Peptidase_S15	210	258	0.014	15.8
TkA01G048910	`PF12146`	Hydrolase_4	211	256	3.7e-11	43.5
TkA01G048910	`PF00561`	Abhydrolase_1	212	259	2.4e-08	34.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card