TkA01G048570 | RubberDandelionOmics

Gene overview

TkA01G048570

Reference: TK1151 Chr: Chr01 Coordinates: 12543035-12547936 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2749 bp · TkA01G048570|TK1151|cDNA

TTGAATTAAACTATGGTACAATTATTGTTTAAATAGAATAAAAAAAGTTGTATGCCAAGAGGACAAAATCTTCCATACCGATTTGACTTCCAAGCTTATCTTTAACCCTAGACTCCATGTGATAACATACGTCCCTCCTTCCTATCCCCTCCCCTTCTTCGAAACCCCAACTGGCCATTTGCGAATCTCGCCGACCTTAATCTCTCTCATATTTTCTTTTTCGGCAAGCAAAAAAAAAACTTTCAACTAATTCACACCCA...

CDS

Download CDS FASTA

1611 bp · TkA01G048570|TK1151|CDS

ATGGCATCAAAGATAGGCAAAGTAACAGCAAATGGTCACAGATTTATTCTCAATTCAAAGAAGAAGGCATTCACTCAATCCAAAACCCAAATAGTCAACAACAGGTCTTTGACTTTAAAGCCCACATTTCAAAAACTTGGAAAAAGAAAAAGGTCAAACAAATGTTCCTCATGTTCAAGAACCACCACCACTTTACTCAAAAACTACTCGAATTTTATCAAGAGTGGGCCACCACAACGTCTGCTCTTCTCCCAAGACGG...

Protein

Download Protein FASTA

536 aa · TkA01G048570|TK1151|PROTEIN

MASKIGKVTANGHRFILNSKKKAFTQSKTQIVNNRSLTLKPTFQKLGKRKRSNKCSSCSRTTTTLLKNYSNFIKSGPPQRLLFSQDGQWVDFPQEVVDLVKDDFCSKKTAIEVKVNGAHFMLQIVYMIQIDLKTGAQKPIAWIDDKGTCVFPEINATCHGSHDDVDLGESSLTPEIKLHLEIEVNGVNSNSNNKFDECMGESIVKRIKFDQESQSQRKVVNDEIAPQKSDEYASPVTETISGNVDVETARKMFVSGFGQD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G048570`
TK1151 ID	TkA01G048570
OH-1004 ID	LXL04_005453
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.300
Protein coverage (%)	TK1151 99.813 / OH-1004 30.467 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G048570

Location Chr01:12543035-12547936 (-)

Description Similar to SKL2: Probable inactive shikimate kinase like 2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g32230`	Inactive ADP-ribosyltransferase that functions with SRO1 to regulate oxidative stress, hormonal and developmental responses.	CEO1, a new protein from Arabidopsis thaliana, protects yeast against oxidative damage.2000 · DOI: 10.1016/s0014-5793(00)02016-0 Ozone-sensitive arabidopsis rcd1 mutant reveals opposite roles for ethylene and jasmonate signaling pathways in regulating superoxide-dependent cell death.2000 · DOI: 10.1105/tpc.12.10.1849 A methyl viologen-resistant mutant of Arabidopsis, which is allelic to ozone-sensitive rcd1, is tolerant to supplemental ultraviolet-B irradiation.2004 · DOI: 10.1104/pp.103.033480 Arabidopsis RADICAL-INDUCED CELL DEATH1 belongs to the WWE protein-protein interaction domain protein family and modulates abscisic acid, ethylene, and methyl jasmonate responses.2004 · DOI: 10.1105/tpc.021832 Ozone-induced programmed cell death in the Arabidopsis radical-induced cell death1 mutant.2005 · DOI: 10.1104/pp.104.055681 Overexpression of the RADICAL-INDUCED CELL DEATH1 (RCD1) gene of Arabidopsis causes weak rcd1 phenotype with compromised oxidative-stress responses.2006 · DOI: 10.1271/bbb.50673 Unequally redundant RCD1 and SRO1 mediate stress and developmental responses and interact with transcription factors.2009 · DOI: 10.1111/j.1365-313x.2009.03951.x The paralogous genes RADICAL-INDUCED CELL DEATH1 and SIMILAR TO RCD ONE1 have partially redundant functions during Arabidopsis development.2009 · DOI: 10.1104/pp.109.142786 RCD1 and SRO1 are necessary to maintain meristematic fate in Arabidopsis thaliana.2011 · DOI: 10.1093/jxb/erq363
`At2g35510`	Probable inactive ADP-ribosyltransferase that functions with RCD1 to regulate oxidative stress, hormonal and developmental responses.	Unequally redundant RCD1 and SRO1 mediate stress and developmental responses and interact with transcription factors.2009 · DOI: 10.1111/j.1365-313x.2009.03951.x The paralogous genes RADICAL-INDUCED CELL DEATH1 and SIMILAR TO RCD ONE1 have partially redundant functions during Arabidopsis development.2009 · DOI: 10.1104/pp.109.142786 RCD1 and SRO1 are necessary to maintain meristematic fate in Arabidopsis thaliana.2011 · DOI: 10.1093/jxb/erq363
`At1g23550`	Probable inactive ADP-ribosyltransferase that may be involved in stress and developmental responses.	No verified direct reference in this release
`At1g70440`	Probable inactive ADP-ribosyltransferase that may be involved in stress and developmental responses.	No verified direct reference in this release
`At5g62520`	Probable inactive ADP-ribosyltransferase that may be involved in stress and developmental responses.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005453 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000303 response to superoxide Biological Process

GO:0000398 mRNA splicing, via spliceosome Biological Process

GO:0002758 innate immune response-activating signaling pathway Biological Process

GO:0006809 nitric oxide biosynthetic process Biological Process

GO:0006950 response to stress Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009073 aromatic amino acid family biosynthetic process Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

KEGG gene cross-reference

ath:AT1G32230

ath:AT1G33520

ath:AT2G35500

ath:AT2G35510

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.904

Rank 1 · TkA01G048570 · TK1151

Cytoplasm0.143

Rank 2 · TkA01G048570 · TK1151

Cell membrane0.038

Rank 3 · TkA01G048570 · TK1151

Endoplasmic reticulum0.024

Rank 4 · TkA01G048570 · TK1151

Plastid0.018

Rank 5 · TkA01G048570 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23467WWE_572-151 aa

PF02825WWE85-141 aa

PF00644PARP326-378 aa

PF12174RST453-517 aa

PF00644PARP455-497 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G048570	`PF23467`	WWE_5	72	151	4.2e-32	111.3
TkA01G048570	`PF02825`	WWE	85	141	0.00031	21.8
TkA01G048570	`PF00644`	PARP	326	378	0.052	13.8
TkA01G048570	`PF12174`	RST	453	517	3.5e-21	75.6
TkA01G048570	`PF00644`	PARP	455	497	0.052	13.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RY59`	Arabidopsis thaliana	sp\|Q8RY59\|RCD1_ARATH Inactive poly [ADP-ribose] polymerase RCD1	36.300%	Swiss-Prot	Medium
`O82289`	Arabidopsis thaliana	sp\|O82289\|SRO1_ARATH Probable inactive poly [ADP-ribose] polymerase SRO1	34.200%	Swiss-Prot	Medium
`Q9ZUD9`	Arabidopsis thaliana	sp\|Q9ZUD9\|SRO2_ARATH Probable inactive poly [ADP-ribose] polymerase SRO2	30.800%	Swiss-Prot	Medium
`O64592`	Arabidopsis thaliana	sp\|O64592\|SRO3_ARATH Probable inactive poly [ADP-ribose] polymerase SRO3	29.100%	Swiss-Prot	Low
`Q9FJJ3`	Arabidopsis thaliana	sp\|Q9FJJ3\|SRO5_ARATH Probable inactive poly [ADP-ribose] polymerase SRO5	28.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card