TkA01G045160 | RubberDandelionOmics

Gene overview

TkA01G045160

Reference: TK1151 Chr: Chr01 Coordinates: 11683274-11684648 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1290 bp · TkA01G045160|TK1151|cDNA

ATAAGATAAGTGGTATAAATGGACTCCATCACATCCAATATATAGTGTGAAGATATCGTATAGAACAGTAGATTTCACAGAGACAAAGATATCATATTCTTCGACTAAGAAAATGCAGAAAAGTGCATCATCTTTGAGCTTGGGTCCAGATGGTCTAAACATAGCACAATCGTTCTTCAAGCCAATTCAAGGTGCAGCGCCACCACCACCTAACAGCCGGAACACCAAAATCACCGTCGTTGGTGTCGGGAACGTCGGTA...

CDS

Download CDS FASTA

1053 bp · TkA01G045160|TK1151|CDS

ATGCAGAAAAGTGCATCATCTTTGAGCTTGGGTCCAGATGGTCTAAACATAGCACAATCGTTCTTCAAGCCAATTCAAGGTGCAGCGCCACCACCACCTAACAGCCGGAACACCAAAATCACCGTCGTTGGTGTCGGGAACGTCGGTATGGCCATCGCACAGACCATCCTCACCCAAGACCTCGCCGACGAGATCGCACTTGTTGATGTCAACGGCGACAAACTCCGCGGAGAAATGCTAGACCTCCAACACGCCGCTGC...

Protein

Download Protein FASTA

350 aa · TkA01G045160|TK1151|PROTEIN

MQKSASSLSLGPDGLNIAQSFFKPIQGAAPPPPNSRNTKITVVGVGNVGMAIAQTILTQDLADEIALVDVNGDKLRGEMLDLQHAAAFLPRTKISASVDYSSTHGSDLVIVTAGARQISGESRLNLLQRNLSLFSKLIPPLAAASPESILLVVSNPVDVLTYVAWKLSGFPSNRVIGSGTNLDSSRFRFLIADHLDLNAQDVQAYIVGEHGDSSVALWSSISVGGVPILSFLERQQIAYEKQTLAKIHKEVVEGAYEVIR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G045160`
TK1151 ID	TkA01G045160
OH-1004 ID	LXL04_005469
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 46.791 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G045160`
Location	Chr01:11683274-11684648 (-)
Description	Similar to L-lactate dehydrogenase A
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_005469` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006089 lactate metabolic process Biological Process GO:0019244 lactate biosynthetic process from pyruvate Biological Process GO:0019661 homolactic fermentation Biological Process GO:0042867 pyruvate catabolic process Biological Process GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005829 cytosol Cellular Component GO:0035686 sperm fibrous sheath Cellular Component GO:1990204 oxidoreductase complex Cellular Component GO:0004457 lactate dehydrogenase activity Molecular Function GO:0004459 L-lactate dehydrogenase (NAD+) activity Molecular Function GO:0019900 kinase binding Molecular Function
KEGG gene cross-reference	mdo:100012604 mdo:503513 mmu:16828 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.610

Rank 1 · TkA01G045160 · TK1151

Nucleus0.242

Rank 2 · TkA01G045160 · TK1151

Peroxisome0.161

Rank 3 · TkA01G045160 · TK1151

Mitochondrion0.125

Rank 4 · TkA01G045160 · TK1151

Plastid0.118

Rank 5 · TkA01G045160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00056Ldh_1_N38-177 aa

PF03807F420_oxidored39-77 aa

PF027373HCDH_N39-84 aa

PF01210NAD_Gly3P_dh_N39-100 aa

PF02866Ldh_1_C180-342 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G045160	`PF00056`	Ldh_1_N	38	177	2.8e-43	148.1
TkA01G045160	`PF03807`	F420_oxidored	39	77	0.091	14.1
TkA01G045160	`PF02737`	3HCDH_N	39	84	0.14	12.8
TkA01G045160	`PF01210`	NAD_Gly3P_dh_N	39	100	0.23	12.1
TkA01G045160	`PF02866`	Ldh_1_C	180	342	1e-32	114.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card