TkA01G043190 | RubberDandelionOmics

Gene overview

TkA01G043190

Reference: TK1151 Chr: Chr01 Coordinates: 11061015-11066359 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1979 bp · TkA01G043190|TK1151|cDNA

CGGCTCGGCTCGTTTACACCCCTAAGAATAACCAAAGTGGAGGAGGGGAGGTAGTTGCCTTCTTTGGCACGTCTTTTTTTTGGGCCTATCAAACTCTATAAATACCCTCCTCCATTCCCTCTTTTTTCTCCTTCCTTTTCTCCCCACACCTACAATTTCGACCAATTCCTCATTCCTCCCTTCTTTCTCCTCACAATCTCATTTATTCTCTCTCTTCAATCGCACAATTCCGTCTCTCAATCAGGATCCCACTGAAGTAT...

CDS

Download CDS FASTA

1161 bp · TkA01G043190|TK1151|CDS

ATGGATTTGAAGCCAAAAAATGCTCCAATTCTATCCGACCCTTCTTCTCCTTTAAACAAATCAAGATTAGGGATGAATTCAAGTATGCTGCCATGTTCACAATCTGGAGCTCCATTTTCCTCAAGTATACTAACTGCTCCAAGAAAGAAGCCCGGGAAGCTTGATGATGTGAGGTCGAATGGGTGGCTTGATGCCATGCAATCTTCTTCACCTCCACGTAAGAAAATAGTCAAAGATTTTGGTGTTGAGGTGGCATCTGA...

Protein

Download Protein FASTA

386 aa · TkA01G043190|TK1151|PROTEIN

MDLKPKNAPILSDPSSPLNKSRLGMNSSMLPCSQSGAPFSSSILTAPRKKPGKLDDVRSNGWLDAMQSSSPPRKKIVKDFGVEVASDDSDIVYNSWMLKYPSALNSFDHIINRGKDKKIVIFLDYDGTLSPIVDDPDRAFMSDDMHSAVKGVAEYFPTAIISGRSRDKVYDLVGLAELYYAGSHGMDIMFPVQDTSCVHQKSYIRSTDKQGKEVNLFQPAREFIPMIDEVFKTLVEVTNDIKGAKVENHKFCTSVHYRNV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G043190`
TK1151 ID	TkA01G043190
OH-1004 ID	LXL04_005491
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G043190

Location Chr01:11061015-11066359 (-)

Description Similar to TPPG: Probable trehalose-phosphate phosphatase G

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g12430`	Removes the phosphate from trehalose 6-phosphate to produce free trehalose.	No verified direct reference in this release
`At4g22590`	Removes the phosphate from trehalose 6-phosphate to produce free trehalose.	No verified direct reference in this release
`At5g51460`	Removes the phosphate from trehalose 6-phosphate to produce free trehalose.	Trehalose-6-phosphate phosphatases from Arabidopsis thaliana: identification by functional complementation of the yeast tps2 mutant.1998 · DOI: 10.1046/j.1365-313x.1998.00064.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0553300`	Removes the phosphate from trehalose 6-phosphate to produce free trehalose.	No verified direct reference in this release
`Os02g0661100`	Removes the phosphate from trehalose 6-phosphate to produce free trehalose.	Functional identification of a trehalose 6-phosphate phosphatase gene that is involved in transient induction of trehalose biosynthesis during chilling stress in rice.2005 · DOI: 10.1007/s11103-005-7404-4 Biochemical characterization of rice trehalose-6-phosphate phosphatases supports distinctive functions of these plant enzymes.2007 · DOI: 10.1111/j.1742-4658.2007.05658.x Overexpression of the trehalose-6-phosphate phosphatase gene OsTPP1 confers stress tolerance in rice and results in the activation of stress responsive genes.2008 · DOI: 10.1007/s00425-008-0729-x

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005491 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005992 trehalose biosynthetic process Biological Process

GO:0009409 response to cold Biological Process

GO:0009651 response to salt stress Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0004805 trehalose-phosphatase activity Molecular Function

KEGG gene cross-reference

ath:AT4G12430

ath:AT4G22590

ath:AT5G51460

dosa:Os02g0661100

dosa:Os10g0553300

osa:4349333

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.498

Rank 1 · TkA01G043190 · TK1151

Nucleus0.379

Rank 2 · TkA01G043190 · TK1151

Mitochondrion0.145

Rank 3 · TkA01G043190 · TK1151

Cell membrane0.067

Rank 4 · TkA01G043190 · TK1151

Endoplasmic reticulum0.054

Rank 5 · TkA01G043190 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02358Trehalose_PPase122-364 aa

PF08282Hydrolase_3284-358 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G043190	`PF02358`	Trehalose_PPase	122	364	1.1e-69	234.9
TkA01G043190	`PF08282`	Hydrolase_3	284	358	0.021	15.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SU39`	Arabidopsis thaliana	sp\|Q9SU39\|TPPF_ARATH Probable trehalose-phosphate phosphatase F	72.100%	Swiss-Prot	High
`Q9SUW0`	Arabidopsis thaliana	sp\|Q9SUW0\|TPPG_ARATH Probable trehalose-phosphate phosphatase G	69.700%	Swiss-Prot	High
`O64896`	Arabidopsis thaliana	sp\|O64896\|TPPA_ARATH Trehalose-phosphate phosphatase A	64.200%	Swiss-Prot	High
`Q9FWQ2`	Oryza sativa subsp. japonica	sp\|Q9FWQ2\|TPP2_ORYSJ Probable trehalose-phosphate phosphatase 2	59.100%	Swiss-Prot	High
`Q75WV3`	Oryza sativa subsp. japonica	sp\|Q75WV3\|TPP1_ORYSJ Probable trehalose-phosphate phosphatase 1	56.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card