TkA01G041220 | RubberDandelionOmics

Gene overview

TkA01G041220

Reference: TK1151 Chr: Chr01 Coordinates: 10611542-10613918 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

787 bp · TkA01G041220|TK1151|cDNA

GTGGACTACAAGGGGGGGCTCTTAACTTTCAACAAAAACCCTTATAAATTAAACCACCTGCCTTTTTCAATCATCAATCAATCGCCATTGTCGTTCACATTCACAGAGAGAAAAGATCACCCACAATTATGGCTTCTTCTTCATCACTCACGGTGGTAGTTGCGCTGATGGTGATGTCCGTATCAGTGTTAACGGCACAGGCGCAGACACAGAATTGTGCGTCGAAGCTAATCCCGTGCGCTCAGTACCTCAACGCCACC...

CDS

Download CDS FASTA

453 bp · TkA01G041220|TK1151|CDS

ATGGCTTCTTCTTCATCACTCACGGTGGTAGTTGCGCTGATGGTGATGTCCGTATCAGTGTTAACGGCACAGGCGCAGACACAGAATTGTGCGTCGAAGCTAATCCCGTGCGCTCAGTACCTCAACGCCACCACAAAGCCGCCGAACTCCTGTTGCGATCCGATCAAAGAGGCGGTGACCACCGATCTACAATGTCTGTGTGGCCTCTATGAGAATCCTTCCTTCTTGGCTGGTCTCGGAATCAATGTTGCTCAGGCACT...

Protein

Download Protein FASTA

150 aa · TkA01G041220|TK1151|PROTEIN

MASSSSLTVVVALMVMSVSVLTAQAQTQNCASKLIPCAQYLNATTKPPNSCCDPIKEAVTTDLQCLCGLYENPSFLAGLGINVAQALRLPRLCDIPSDVSACDNAQSPSGSTTQPPPGRTPGAGNSAGNVASSGVIGLVLVLVSACVMLF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G041220`
TK1151 ID	TkA01G041220
OH-1004 ID	LXL04_005503
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G041220`
Location	Chr01:10611542-10613918 (-)
Description	Similar to VAS: Lipid transfer-like protein VAS
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_005503` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006508 proteolysis Biological Process GO:0005886 plasma membrane Cellular Component GO:0009507 chloroplast Cellular Component GO:0016020 membrane Cellular Component GO:0098552 side of membrane Cellular Component GO:0008233 peptidase activity Molecular Function
KEGG gene cross-reference	ath:AT1G18280 ath:AT1G62790 ath:AT1G73550 ath:AT1G73560 ath:AT4G12360 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.761

Rank 1 · TkA01G041220 · TK1151

Cytoplasm0.093

Rank 2 · TkA01G041220 · TK1151

Endoplasmic reticulum0.090

Rank 3 · TkA01G041220 · TK1151

Extracellular0.074

Rank 4 · TkA01G041220 · TK1151

Lysosome / Vacuole0.049

Rank 5 · TkA01G041220 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27998ArabinogalactanP5-49 aa

PF14368LTP_211-102 aa

PF00234Tryp_alpha_amyl31-98 aa

PF27998ArabinogalactanP103-149 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G041220	`PF27998`	ArabinogalactanP	5	49	0.35	11.8
TkA01G041220	`PF14368`	LTP_2	11	102	1.8e-17	64.0
TkA01G041220	`PF00234`	Tryp_alpha_amyl	31	98	9.3e-06	26.5
TkA01G041220	`PF27998`	ArabinogalactanP	103	149	0.35	11.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card