TkA01G038510 | RubberDandelionOmics

Gene overview

TkA01G038510

Reference: TK1151 Chr: Chr01 Coordinates: 9959382-9961360 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1032 bp · TkA01G038510|TK1151|cDNA

ATGCGTACAAGGGCAAAGGAATTGCTGACTTCCTCTCTACAGCTTCTGGTGGTGGAAATGGTCCTCCCCCTTTCCCGGTTTCCTTCAATTTCCATTCCCGCTATCATATGTCTTCTGGAAATGGAAAACAGCCGAAATTACCTCGACATTGAAGCAACTTCATCTTTTAATGCCAGCCTTTCTGATGACGAATACATAATGGCACCAGTAGATAAACAAGTAGAGCAACCAGATGATACCATGGCTGATGAAGATGATAC...

CDS

Download CDS FASTA

1032 bp · TkA01G038510|TK1151|CDS

ATGCGTACAAGGGCAAAGGAATTGCTGACTTCCTCTCTACAGCTTCTGGTGGTGGAAATGGTCCTCCCCCTTTCCCGGTTTCCTTCAATTTCCATTCCCGCTATCATATGTCTTCTGGAAATGGAAAACAGCCGAAATTACCTCGACATTGAAGCAACTTCATCTTTTAATGCCAGCCTTTCTGATGACGAATACATAATGGCACCAGTAGATAAACAAGTAGAGCAACCAGATGATACCATGGCTGATGAAGATGATAC...

Protein

Download Protein FASTA

343 aa · TkA01G038510|TK1151|PROTEIN

MRTRAKELLTSSLQLLVVEMVLPLSRFPSISIPAIICLLEMENSRNYLDIEATSSFNASLSDDEYIMAPVDKQVEQPDDTMADEDDTQDPDEDEQLNHVIFSEVMNKLVNEGILSKSGTDSFNIKRPRKTEFEFDAVKEEGEKKSPSTMLDGDMYMKALFHALPMDYITIPKLQSKLGGEVNQTMVRKLMDKTTKEGFIETSSSRRLGKRVVHSEITNKKLDEVRKALDFDASENLAAGTNRSTVGAFHSIGSERTRSTG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G038510`
TK1151 ID	TkA01G038510
OH-1004 ID	LXL04_011387
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	88.600
Protein coverage (%)	TK1151 100.000 / OH-1004 64.912 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G038510

Location Chr01:9959382-9961360 (-)

Description Similar to ASY1: Meiosis-specific protein ASY1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: F4HRV8`	Required for normal meiosis in male and female gametophytes.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0506800`	Essential factor for meiotic homologous chromosome pairing (synapsis).	An insertional mutation in the rice PAIR2 gene, the ortholog of Arabidopsis ASY1, results in a defect in homologous chromosome pairing during meiosis.2004 · DOI: 10.1007/s00438-003-0934-z PAIR2 is essential for homologous chromosome synapsis in rice meiosis I.2006 · DOI: 10.1242/jcs.02736

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011387 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007129 homologous chromosome pairing at meiosis Biological Process

GO:0007130 synaptonemal complex assembly Biological Process

GO:0009554 megasporogenesis Biological Process

GO:0009556 microsporogenesis Biological Process

GO:0009620 response to fungus Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0010439 regulation of glucosinolate biosynthetic process Biological Process

GO:0019761 glucosinolate biosynthetic process Biological Process

GO:0051026 chiasma assembly Biological Process

GO:0051598 meiotic recombination checkpoint signaling Biological Process

GO:0000228 nuclear chromosome Cellular Component

GO:0000775 chromosome, centromeric region Cellular Component

KEGG gene cross-reference

ath:AT1G06620

ath:AT1G06650

ath:AT1G67370

ath:AT2G25450

dosa:Os09g0506800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.913

Rank 1 · TkA01G038510 · TK1151

Cytoplasm0.182

Rank 2 · TkA01G038510 · TK1151

Mitochondrion0.027

Rank 3 · TkA01G038510 · TK1151

Cell membrane0.021

Rank 4 · TkA01G038510 · TK1151

Endoplasmic reticulum0.010

Rank 5 · TkA01G038510 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07574SMC_Nse169-121 aa

PF07574SMC_Nse1253-253 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G038510	`PF07574`	SMC_Nse1	69	121	0.12	13.0
TkA01G038510	`PF07574`	SMC_Nse1	253	253	0.12	13.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HRV8`	Arabidopsis thaliana	sp\|F4HRV8\|ASY1_ARATH Meiosis-specific protein ASY1	41.100%	Swiss-Prot	Medium
`Q76CY8`	Oryza sativa subsp. japonica	sp\|Q76CY8\|PAIR2_ORYSJ Meiosis-specific protein PAIR2	34.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card