TkA01G037650 | RubberDandelionOmics

Gene overview

TkA01G037650

Reference: TK1151 Chr: Chr01 Coordinates: 9739562-9740737 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1146 bp · TkA01G037650|TK1151|cDNA

ATGGACATCCACCACGAACAAGAGCTCGAAGGACTCGAATTATTCCAGAAACACGTTTCCGATCGTTTCAGTCAGCTCTTACCACTTCAACCCTCCTTACTTCCGACCATCGGAGAAGAAATAGTAGCCGTCGACACGCCGGAAACCTTCTTATCAATCGATTGGTTCCGAAAACTCCTCGACGTGTATCTTTGCTGCGAGTCGGAATTTAAAGCGGTGTTGATAATCGGCCGGGACGCCACTCATTTCTCCAAACCGCC...

CDS

Download CDS FASTA

1146 bp · TkA01G037650|TK1151|CDS

ATGGACATCCACCACGAACAAGAGCTCGAAGGACTCGAATTATTCCAGAAACACGTTTCCGATCGTTTCAGTCAGCTCTTACCACTTCAACCCTCCTTACTTCCGACCATCGGAGAAGAAATAGTAGCCGTCGACACGCCGGAAACCTTCTTATCAATCGATTGGTTCCGAAAACTCCTCGACGTGTATCTTTGCTGCGAGTCGGAATTTAAAGCGGTGTTGATAATCGGCCGGGACGCCACTCATTTCTCCAAACCGCC...

Protein

Download Protein FASTA

381 aa · TkA01G037650|TK1151|PROTEIN

MDIHHEQELEGLELFQKHVSDRFSQLLPLQPSLLPTIGEEIVAVDTPETFLSIDWFRKLLDVYLCCESEFKAVLIIGRDATHFSKPPLDRLIPEHLDRTVKALDICNAITHGIELIRHWQRLAQIAVEALQQRPIVAGHVRRAKRALNTLLTSMMVDDKENMNNHVVGRRGGGGAPTTVNHNRTNSGNPRSFSFCFSKSWSASKQIHAMSNNLVVPRGGEPTGLALPVYVMSSVLVLVMWTLVAAVPCQEKVGLNGTHFQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G037650`
TK1151 ID	TkA01G037650
OH-1004 ID	LXL04_026407
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	60.300
Protein coverage (%)	TK1151 98.950 / OH-1004 93.947 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G037650

Location Chr01:9739562-9740737 (+)

Description Similar to ROH1: Protein ROH1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g63930`	Required for seed coat mucilage deposition.	Arabidopsis exocyst subunits SEC8 and EXO70A1 and exocyst interactor ROH1 are involved in the localized deposition of seed coat pectin.2010 · DOI: 10.1111/j.1469-8137.2010.03372.x
`At1g18740`	Together with TRANSTHYRETIN-LIKE protein (TTL), prevents plant growth and development, but by opposition to TTL, regulates positively cold tolerance, probably in a brassinosteroid (BR) and allantoin-dependent manner.	No verified direct reference in this release
`At1g74450`	Involved in the regulation of plant growth, and modulates pollen development to ensure male fertility.	Overexpressing the Multiple-Stress Responsive Gene At1g74450 Reduces Plant Height and Male Fertility in Arabidopsis thaliana.2015 · DOI: 10.1371/journal.pone.0140368

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026407 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006887 exocytosis Biological Process

GO:0006904 vesicle docking involved in exocytosis Biological Process

GO:0009409 response to cold Biological Process

GO:0009555 pollen development Biological Process

GO:0009631 cold acclimation Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0010214 seed coat development Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0019428 allantoin biosynthetic process Biological Process

GO:0040008 regulation of growth Biological Process

KEGG gene cross-reference

ath:AT1G18740

ath:AT1G63930

ath:AT1G74450

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.589

Rank 1 · TkA01G037650 · TK1151

Nucleus0.364

Rank 2 · TkA01G037650 · TK1151

Cell membrane0.234

Rank 3 · TkA01G037650 · TK1151

Endoplasmic reticulum0.049

Rank 4 · TkA01G037650 · TK1151

Golgi apparatus0.027

Rank 5 · TkA01G037650 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05633ROH1-like1-369 aa

PF05055DUF67774-132 aa

PF05055DUF677293-341 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G037650	`PF05633`	ROH1-like	1	369	4e-136	454.8
TkA01G037650	`PF05055`	DUF677	74	132	0.024	14.3
TkA01G037650	`PF05055`	DUF677	293	341	0.024	14.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9CAK4`	Arabidopsis thaliana	sp\|Q9CAK4\|ROH1A_ARATH Protein ROH1A	52.300%	Swiss-Prot	High
`Q9M9U5`	Arabidopsis thaliana	sp\|Q9M9U5\|B1L_ARATH Protein BYPASS1-LIKE	38.900%	Swiss-Prot	Medium
`Q9CA69`	Arabidopsis thaliana	sp\|Q9CA69\|ROH1D_ARATH Protein ROH1D	40.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card