TkA01G034340 | RubberDandelionOmics

Gene overview

TkA01G034340

Reference: TK1151 Chr: Chr01 Coordinates: 8949176-8950513 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

963 bp · TkA01G034340|TK1151|cDNA

GCCTTTTCCAGAAAATACGGTCCTAATGGGTCTATAAAGATCCTAAAACAAATCTTGACCCTTCACAAAGGTCCTATCTTGAATTTTCATCTCCGTATTCCAAAACTACCTCTTGATAGCTTCCAAGAAGTTGATGAGTGCATGCTATTGTTATCAAGAAAAGGTGCCACGGATGTCATGCTTTCCAACTCAAATGGAAGTCATTATCAACTTCCATCCGATGTGTTGTTCTCTTGTCAAGAATTGAAAACGTTGAAACT...

CDS

Download CDS FASTA

963 bp · TkA01G034340|TK1151|CDS

GCCTTTTCCAGAAAATACGGTCCTAATGGGTCTATAAAGATCCTAAAACAAATCTTGACCCTTCACAAAGGTCCTATCTTGAATTTTCATCTCCGTATTCCAAAACTACCTCTTGATAGCTTCCAAGAAGTTGATGAGTGCATGCTATTGTTATCAAGAAAAGGTGCCACGGATGTCATGCTTTCCAACTCAAATGGAAGTCATTATCAACTTCCATCCGATGTGTTGTTCTCTTGTCAAGAATTGAAAACGTTGAAACT...

Protein

Download Protein FASTA

320 aa · TkA01G034340|TK1151|PROTEIN

AFSRKYGPNGSIKILKQILTLHKGPILNFHLRIPKLPLDSFQEVDECMLLLSRKGATDVMLSNSNGSHYQLPSDVLFSCQELKTLKLHNFLFKPPLEFKGSSLYNVEHLHLSDIDFGDSLWSNESINLPKLKNLTMCVCKNTHNFNINATNLEIFGVPKPKEDLARVEKTTFSMMLSNLPKIKHFLINNHFLKAFTAEIIPKWLPHPLNCLEDLLLRGFQLGNLDDLNHALFLVRNSPNLKELCMILSGLETVDIKFFEG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G034340`
TK1151 ID	TkA01G034340
OH-1004 ID	LXL04_033507
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	45.900
Protein coverage (%)	TK1151 97.500 / OH-1004 83.066 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G034340`
Location	Chr01:8949176-8950513 (-)
Description	Similar to At1g13570: F-box/FBD/LRR-repeat protein At1g13570
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_033507` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0005634 nucleus Cellular Component
KEGG gene cross-reference	ath:AT1G13570 ath:AT1G32375 ath:AT5G50270 ath:AT5G56370 ath:AT5G56420 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.753

Rank 1 · TkA01G034340 · TK1151

Cytoplasm0.306

Rank 2 · TkA01G034340 · TK1151

Endoplasmic reticulum0.040

Rank 3 · TkA01G034340 · TK1151

Cell membrane0.036

Rank 4 · TkA01G034340 · TK1151

Extracellular0.019

Rank 5 · TkA01G034340 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24758LRR_At5g5637045-116 aa

PF08387FBD82-90 aa

PF24758LRR_At5g56370108-140 aa

PF23640UPA_SH3BP4120-188 aa

PF24758LRR_At5g56370142-175 aa

PF08387FBD222-243 aa

PF24758LRR_At5g56370232-250 aa

PF08387FBD246-283 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G034340	`PF24758`	LRR_At5g56370	45	116	0.0012	19.3
TkA01G034340	`PF08387`	FBD	82	90	1.5e-08	35.1
TkA01G034340	`PF24758`	LRR_At5g56370	108	140	0.0012	19.3
TkA01G034340	`PF23640`	UPA_SH3BP4	120	188	0.058	14.3
TkA01G034340	`PF24758`	LRR_At5g56370	142	175	0.0012	19.3
TkA01G034340	`PF08387`	FBD	222	243	1.5e-08	35.1
TkA01G034340	`PF24758`	LRR_At5g56370	232	250	0.0012	19.3
TkA01G034340	`PF08387`	FBD	246	283	1.5e-08	35.1
TkA01G034340	`PF24758`	LRR_At5g56370	269	285	0.0012	19.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card