TkA01G034320 | RubberDandelionOmics

Gene overview

TkA01G034320

Reference: TK1151 Chr: Chr01 Coordinates: 8937800-8938513 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

714 bp · TkA01G034320|TK1151|cDNA

ATGGCCTATAATTCCGAATTGAAATATGGGTCGGATTTGAACACTGTCGAGATTCCAGAATCTTGCAGAAACGATGAACTGTCTGTAAATCCCGATTTGTATGATAACGGATTGAGGGAATTGTTCGATCAAGTTCTTTCGTTCTTCTTAAAAGAAACATCTTTGAAAACAAATGCGATTAGGCCTTTTCCACCTAAACTCGGTGAAGGGGTAGAAGCCGATTTATTCAAACTGTTCTTGACTGTGAAAAGAATAGGAAG...

CDS

Download CDS FASTA

714 bp · TkA01G034320|TK1151|CDS

ATGGCCTATAATTCCGAATTGAAATATGGGTCGGATTTGAACACTGTCGAGATTCCAGAATCTTGCAGAAACGATGAACTGTCTGTAAATCCCGATTTGTATGATAACGGATTGAGGGAATTGTTCGATCAAGTTCTTTCGTTCTTCTTAAAAGAAACATCTTTGAAAACAAATGCGATTAGGCCTTTTCCACCTAAACTCGGTGAAGGGGTAGAAGCCGATTTATTCAAACTGTTCTTGACTGTGAAAAGAATAGGAAG...

Protein

Download Protein FASTA

237 aa · TkA01G034320|TK1151|PROTEIN

MAYNSELKYGSDLNTVEIPESCRNDELSVNPDLYDNGLRELFDQVLSFFLKETSLKTNAIRPFPPKLGEGVEADLFKLFLTVKRIGSYEIVSENNLWEFVAKECGFEIGVEGSLKLVYVKYLKELDQWLIEGGFKENLDTRVIEKLDLLSQQLDEYICFESNQIGKSLDEGTSGFNQNEGGMNLDVPFSIINGDDDDEKFRVGDDKRCELSSEIVKKVGVSMINDDVKEPSYRLKML

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G034320`
TK1151 ID	TkA01G034320
OH-1004 ID	LXL04_005557
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.100
Protein coverage (%)	TK1151 96.203 / OH-1004 34.545 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G034320`
Location	Chr01:8937800-8938513 (-)
Description	Similar to ARID2: AT-rich interactive domain-containing protein 2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_005557` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006351 DNA-templated transcription Biological Process GO:0010628 positive regulation of gene expression Biological Process GO:0048235 pollen sperm cell differentiation Biological Process GO:0000118 histone deacetylase complex Cellular Component GO:0005634 nucleus Cellular Component GO:0005773 vacuole Cellular Component GO:0048555 generative cell nucleus Cellular Component GO:0048556 microsporocyte nucleus Cellular Component GO:0003677 DNA binding Molecular Function
KEGG gene cross-reference	ath:AT2G46040 ath:AT4G11400 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.976

Rank 1 · TkA01G034320 · TK1151

Cytoplasm0.083

Rank 2 · TkA01G034320 · TK1151

Cell membrane0.018

Rank 3 · TkA01G034320 · TK1151

Plastid0.010

Rank 4 · TkA01G034320 · TK1151

Endoplasmic reticulum0.009

Rank 5 · TkA01G034320 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01388ARID40-124 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G034320	`PF01388`	ARID	40	124	7.5e-10	39.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card