Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1419 bp · TkA01G034220|TK1151|cDNA
ATGCCTCCTTTTTCACAATCGGGCCCTCTCTCTGTTCCATTTTCCCACGAGAATCACAAATTCGACAAGCCCAGCAACCTCTCGTCCACCAATGTCGTCACCATTGACGTCGGCGGCCAGCTCTTTCAAACCACGAAACAAACCCTAACTCTAGCTGGCTCCAACACCCTGTTCTCCAATATCTTCACGACTTACGATCAAATTCCGTTTATCGACAGAGACCCTGATCTTTTCTCAATTCTTCTTTCCGTTTTGAGAAC...
1419 bp · TkA01G034220|TK1151|CDS
ATGCCTCCTTTTTCACAATCGGGCCCTCTCTCTGTTCCATTTTCCCACGAGAATCACAAATTCGACAAGCCCAGCAACCTCTCGTCCACCAATGTCGTCACCATTGACGTCGGCGGCCAGCTCTTTCAAACCACGAAACAAACCCTAACTCTAGCTGGCTCCAACACCCTGTTCTCCAATATCTTCACGACTTACGATCAAATTCCGTTTATCGACAGAGACCCTGATCTTTTCTCAATTCTTCTTTCCGTTTTGAGAAC...
Protein
Download Protein FASTA472 aa · TkA01G034220|TK1151|PROTEIN
MPPFSQSGPLSVPFSHENHKFDKPSNLSSTNVVTIDVGGQLFQTTKQTLTLAGSNTLFSNIFTTYDQIPFIDRDPDLFSILLSVLRTGNFPSKAKAFDIQDIISEAKFYGIDHLVVQSHSNPSQFDAFNLEKSTILPLSGRDSPSVVATSPYGLVNVAHGSKITSFDWSLRGKSTILTPFTAIDSLLSLSSNVVAAGATDFSGLQIININKGSVVQSLNWENITRSSSTVQAIGTSPDFLFTSFESGRRNSNSIMVYDIN...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G034220 |
|---|---|
| TK1151 ID | TkA01G034220 |
| OH-1004 ID | LXL04_005562 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G034220 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:8900629-8902047 (-) | |||||||||
| Description | Similar to At5g41330: BTB/POZ domain-containing protein At5g41330 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006511 ubiquitin-dependent protein catabolic process Biological Process GO:0006886 intracellular protein transport Biological Process GO:0009737 response to abscisic acid Biological Process GO:0016567 protein ubiquitination Biological Process GO:0035024 negative regulation of Rho protein signal transduction Biological Process GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process GO:0050832 defense response to fungus Biological Process GO:0051260 protein homooligomerization Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT2G24240 ath:AT3G09030 ath:AT4G30940 ath:AT5G41330 hsa:83892 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF13570Beta-prop_ACSF427-62 aaPF02214BTB_233-117 aaPF00651BTB33-119 aaPF02122Peptidase_S39122-151 aaPF25279Beta_prop_At2g24240145-466 aaPF25171Beta-prop_WDR36-Utp21_1st152-301 aaPF24796WDR55163-200 aaPF24807WD40_CDC20-Fz183-262 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G034220 | PF13570 | Beta-prop_ACSF4 | 27 | 62 | 0.075 | 13.1 |
| TkA01G034220 | PF02214 | BTB_2 | 33 | 117 | 6.9e-12 | 46.3 |
| TkA01G034220 | PF00651 | BTB | 33 | 119 | 0.0052 | 17.7 |
| TkA01G034220 | PF02122 | Peptidase_S39 | 122 | 151 | 0.18 | 12.1 |
| TkA01G034220 | PF25279 | Beta_prop_At2g24240 | 145 | 466 | 3e-18 | 66.5 |
| TkA01G034220 | PF25171 | Beta-prop_WDR36-Utp21_1st | 152 | 301 | 0.00015 | 22.0 |
| TkA01G034220 | PF24796 | WDR55 | 163 | 200 | 1.6e-05 | 24.9 |
| TkA01G034220 | PF24807 | WD40_CDC20-Fz | 183 | 262 | 0.047 | 13.7 |
| TkA01G034220 | PF25174 | Beta-prop_THOC3 | 188 | 222 | 0.014 | 15.1 |
| TkA01G034220 | PF25174 | Beta-prop_THOC3 | 191 | 243 | 0.014 | 15.1 |
| TkA01G034220 | PF13570 | Beta-prop_ACSF4 | 192 | 230 | 0.075 | 13.1 |
| TkA01G034220 | PF02122 | Peptidase_S39 | 192 | 243 | 0.18 | 12.1 |
| TkA01G034220 | PF24814 | WD40_Prp19 | 194 | 219 | 0.17 | 11.6 |
| TkA01G034220 | PF25174 | Beta-prop_THOC3 | 287 | 370 | 0.014 | 15.1 |
| TkA01G034220 | PF24807 | WD40_CDC20-Fz | 288 | 330 | 0.047 | 13.7 |
| TkA01G034220 | PF13570 | Beta-prop_ACSF4 | 309 | 376 | 0.075 | 13.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.