TkA01G033630 | RubberDandelionOmics

Gene overview

TkA01G033630

Reference: TK1151 Chr: Chr01 Coordinates: 8756607-8758814 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1914 bp · TkA01G033630|TK1151|cDNA

GAAAAAGGTTGAAGGGGGTAAAATGCAATTTTCGCTAATATGTAAACTCCTCAACACCAGTTATTAACCCTAGCCTTCCCGCCAACTGTCAAAAACCCTAGCCTACTTCCCTTAAACCCTCGTCCCCTTTTTTTCAATCACCTCAATCTTATCGAAGAAATTATCCATCAATGGAGGCTCAAGCCGTGAAATCAAACCTCGTTCTAATCCTAGATTACGGTTCGCAGTACACCCACCTAATCACTCGTCGAATCCGAAGC...

CDS

Download CDS FASTA

1608 bp · TkA01G033630|TK1151|CDS

ATGGAGGCTCAAGCCGTGAAATCAAACCTCGTTCTAATCCTAGATTACGGTTCGCAGTACACCCACCTAATCACTCGTCGAATCCGAAGCTTATCCGTCTTCTCCCTCTGTATTTCCGGCACTTCCTCACTCAAATCCATCACCGACTTAAACCCATCCGTAATCATCCTCTCCGGCGGCCCCCATTCCGTCCATGCACAGGATGCTCCTTCCTTCCCAGATGGATTCGTGGAGTATGTTGAAAAAGCAGGCATCTTTGT...

Protein

Download Protein FASTA

535 aa · TkA01G033630|TK1151|PROTEIN

MEAQAVKSNLVLILDYGSQYTHLITRRIRSLSVFSLCISGTSSLKSITDLNPSVIILSGGPHSVHAQDAPSFPDGFVEYVEKAGIFVLGICYGLQLIVQKLGGQVAIGEKQEYGRMTIEVVKEYGGLFKGKTIGDKQVVWMSHGDEAVKLPAGFEVVARSEQGGVAAVANLSRRFYGLQYHPEVTHSPEGMELLRHFLFDISGVTAGWKMEDVMEEEIKVIKGMVGPDDHVICALSGGVDSTVAATLVHKAIGDRLHCIF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G033630`
TK1151 ID	TkA01G033630
OH-1004 ID	LXL04_002681
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	58.200
Protein coverage (%)	TK1151 29.533 / OH-1004 57.589 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G033630`
Location	Chr01:8756607-8758814 (-)
Description	Similar to guaA: GMP synthase [glutamine-hydrolyzing] (Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_002681` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006177 GMP biosynthetic process Biological Process GO:0005829 cytosol Cellular Component GO:0003921 GMP synthase activity Molecular Function GO:0005524 ATP binding Molecular Function
KEGG gene cross-reference	dra:DR_1874 pmc:P9515_00361 pmm:PMM0037 taf:THA_1090 tme:Tmel_0718 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.764

Rank 1 · TkA01G033630 · TK1151

Nucleus0.292

Rank 2 · TkA01G033630 · TK1151

Mitochondrion0.090

Rank 3 · TkA01G033630 · TK1151

Peroxisome0.078

Rank 4 · TkA01G033630 · TK1151

Cell membrane0.039

Rank 5 · TkA01G033630 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00117GATase12-200 aa

PF06508QueC63-82 aa

PF13507GATase_572-107 aa

PF07722Peptidase_C2679-183 aa

PF01171ATP_bind_3227-268 aa

PF02568ThiI228-273 aa

PF02540NAD_synthase229-255 aa

PF03054tRNA_Me_trans230-277 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G033630	`PF00117`	GATase	12	200	6.3e-38	131.1
TkA01G033630	`PF06508`	QueC	63	82	0.0029	17.8
TkA01G033630	`PF13507`	GATase_5	72	107	0.084	12.7
TkA01G033630	`PF07722`	Peptidase_C26	79	183	7.3e-08	33.2
TkA01G033630	`PF01171`	ATP_bind_3	227	268	0.11	12.6
TkA01G033630	`PF02568`	ThiI	228	273	0.0083	16.5
TkA01G033630	`PF02540`	NAD_synthase	229	255	2.6e-07	30.7
TkA01G033630	`PF03054`	tRNA_Me_trans	230	277	0.00021	21.8
TkA01G033630	`PF06508`	QueC	231	300	0.0029	17.8
TkA01G033630	`PF01507`	PAPS_reduct	231	296	0.028	15.1
TkA01G033630	`PF06508`	QueC	368	404	0.0029	17.8
TkA01G033630	`PF03054`	tRNA_Me_trans	381	399	0.00021	21.8
TkA01G033630	`PF02540`	NAD_synthase	382	411	2.6e-07	30.7
TkA01G033630	`PF00958`	GMP_synt_C	444	534	5.8e-40	136.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card