TkA01G033080 | RubberDandelionOmics

Gene overview

TkA01G033080

Reference: TK1151 Chr: Chr01 Coordinates: 8586682-8587286 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

364 bp · TkA01G033080|TK1151|cDNA

GTTTCTTAGATGGAAAAATAAAGAACGCGGATAAATAAACTTCATGGATTTTCAACATGGATCATTAAAGGAATTAAAAATGGGTAATGAGTTTATCAAGCAAGAAGTTTTGAAGACACAACAGATTTACTCTGAGGAAATCAATCAATTTGGGATGAAGATTCAAGGGCTTGTAGATGCTGCGCAAAATTACCATACAGTCCTTACAGAAAACAGAAAGCTATACAATGAAGTTCAAGATCTGAAAGGGAACATCAGGG...

CDS

Download CDS FASTA

321 bp · TkA01G033080|TK1151|CDS

ATGGATTTTCAACATGGATCATTAAAGGAATTAAAAATGGGTAATGAGTTTATCAAGCAAGAAGTTTTGAAGACACAACAGATTTACTCTGAGGAAATCAATCAATTTGGGATGAAGATTCAAGGGCTTGTAGATGCTGCGCAAAATTACCATACAGTCCTTACAGAAAACAGAAAGCTATACAATGAAGTTCAAGATCTGAAAGGGAACATCAGGGTTTATTGTCGTATAAGGCCATTTCTCAAGGGTCAAAGTCAAAA...

Protein

Download Protein FASTA

107 aa · TkA01G033080|TK1151|PROTEIN

MDFQHGSLKELKMGNEFIKQEVLKTQQIYSEEINQFGMKIQGLVDAAQNYHTVLTENRKLYNEVQDLKGNIRVYCRIRPFLKGQSQKQTTIEYNGENGELIVTNPSK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G033080`
TK1151 ID	TkA01G033080
OH-1004 ID	LXL04_005570
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 5.719 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G033080

Location Chr01:8586682-8587286 (-)

Description Similar to KIN14K: Kinesin-like protein KIN-14K

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g63640`	Kinesin-like protein KIN-14J.	No verified direct reference in this release
`At1g18410`	Kinesin-like protein KIN-14O.	No verified direct reference in this release
`At5g41310`	Kinesin-like protein KIN-14K.	No verified direct reference in this release
`At1g73860`	Kinesin-like protein KIN-14P.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0744000`	Kinesin-like protein KIN-14C.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005570 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007017 microtubule-based process Biological Process

GO:0007018 microtubule-based movement Biological Process

GO:0098542 defense response to other organism Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005874 microtubule Cellular Component

GO:0015630 microtubule cytoskeleton Cellular Component

GO:0003777 microtubule motor activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0008017 microtubule binding Molecular Function

GO:0043531 ADP binding Molecular Function

KEGG gene cross-reference

ath:AT1G63640

ath:AT3G14470

ath:AT5G41310

dosa:Os01g0744000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.685

Rank 1 · TkA01G033080 · TK1151

Nucleus0.294

Rank 2 · TkA01G033080 · TK1151

Mitochondrion0.055

Rank 3 · TkA01G033080 · TK1151

Cell membrane0.040

Rank 4 · TkA01G033080 · TK1151

Endoplasmic reticulum0.037

Rank 5 · TkA01G033080 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29116PET1309-53 aa

PF02183HALZ11-21 aa

PF01231IDO23-94 aa

PF16796Microtub_bd24-29 aa

PF14775NYD-SP28_assoc43-68 aa

PF02183HALZ49-69 aa

PF16796Microtub_bd55-97 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G033080	`PF29116`	PET130	9	53	0.042	13.8
TkA01G033080	`PF02183`	HALZ	11	21	0.018	15.9
TkA01G033080	`PF01231`	IDO	23	94	0.088	12.3
TkA01G033080	`PF16796`	Microtub_bd	24	29	5.3e-10	40.1
TkA01G033080	`PF14775`	NYD-SP28_assoc	43	68	0.011	16.6
TkA01G033080	`PF02183`	HALZ	49	69	0.018	15.9
TkA01G033080	`PF16796`	Microtub_bd	55	97	5.3e-10	40.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`B3H6Z8`	Arabidopsis thaliana	sp\|B3H6Z8\|KN14J_ARATH Kinesin-like protein KIN-14J	61.700%	Swiss-Prot	High
`F4IAR2`	Arabidopsis thaliana	sp\|F4IAR2\|KN14O_ARATH Kinesin-like protein KIN-14O	56.100%	Swiss-Prot	High
`F4JX00`	Arabidopsis thaliana	sp\|F4JX00\|KN14K_ARATH Kinesin-like protein KIN-14K	55.100%	Swiss-Prot	High
`Q0WN69`	Arabidopsis thaliana	sp\|Q0WN69\|KN14P_ARATH Kinesin-like protein KIN-14P	55.100%	Swiss-Prot	High
`Q5JKW1`	Oryza sativa subsp. japonica	sp\|Q5JKW1\|KN14C_ORYSJ Kinesin-like protein KIN-14C	57.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card