Gene Card
Gene overview
cDNA / CDS / Protein Sequences
333 bp · TkA01G031720|TK1151|cDNA
ATGACCCCCAGCTCAGCTGGGGAGAGGCATCCGGGTTATAGTCCACATGGGGCGAAGGTCAGGAGTTCGACTCCTAGCTGGAGCAGCTTGTGGGATTTTCCCTGGACGGTAGACCGAGTTCGAGGCCCTTTCGAACGCCTGAAGTACCCCTTAGCGGGAAACTGGGTGCGGGAGATTGGGGGTGGGTTTACTCTTCGGAGCAGACTCGAACTCGGGGCGTTGCCGCTAAGAGCAGTCGGTGGCACGATGATACGCCGCTG...
333 bp · TkA01G031720|TK1151|CDS
ATGACCCCCAGCTCAGCTGGGGAGAGGCATCCGGGTTATAGTCCACATGGGGCGAAGGTCAGGAGTTCGACTCCTAGCTGGAGCAGCTTGTGGGATTTTCCCTGGACGGTAGACCGAGTTCGAGGCCCTTTCGAACGCCTGAAGTACCCCTTAGCGGGAAACTGGGTGCGGGAGATTGGGGGTGGGTTTACTCTTCGGAGCAGACTCGAACTCGGGGCGTTGCCGCTAAGAGCAGTCGGTGGCACGATGATACGCCGCTG...
Protein
Download Protein FASTA110 aa · TkA01G031720|TK1151|PROTEIN
MTPSSAGERHPGYSPHGAKVRSSTPSWSSLWDFPWTVDRVRGPFERLKYPLAGNWVREIGGGFTLRSRLELGALPLRAVGGTMIRRCTRLPFKKKMNKHCVRPLNTRLDM
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G031720 |
|---|---|
| TK1151 ID | TkA01G031720 |
| OH-1004 ID | LXL04_017222 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 44.300 |
| Protein coverage (%) | TK1151 54.545 / OH-1004 6.295Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G031720 |
|---|---|
| Location | Chr01:8194926-8195258 (-) |
| Description | Similar to DRP3A: Dynamin-related protein 3A |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000001 mitochondrion inheritance Biological Process GO:0000266 mitochondrial fission Biological Process GO:0006816 calcium ion transport Biological Process GO:0006897 endocytosis Biological Process GO:0007005 mitochondrion organization Biological Process GO:0007031 peroxisome organization Biological Process GO:0010468 regulation of gene expression Biological Process GO:0010637 negative regulation of mitochondrial fusion Biological Process GO:0010821 regulation of mitochondrion organization Biological Process GO:0015886 heme transport Biological Process GO:0016050 vesicle organization Biological Process GO:0016236 macroautophagy Biological Process |
| KEGG gene cross-reference | ath:AT2G14120 ath:AT4G33650 hsa:10059 mmu:74006 sce:YLL001W These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.