TkA01G028170 | RubberDandelionOmics

Gene overview

TkA01G028170

Reference: TK1151 Chr: Chr01 Coordinates: 7220871-7221575 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

705 bp · TkA01G028170|TK1151|cDNA

ATGACCGAGAACAATCTAATCGGTAGTGGTGGTTCAGGGAAAGTGTACAAGATTAAAATCGGTAAAGGTTGTGGTGAGTATGTTGCAGTCAAGACGATTTGGAACCCTAGAAAACTCGATCACGTCCTCGAGAAAGAGTTCTTATCAGAAGTTCATATATTGGGCACAATTCGTCATTCAAACATCGTCAAATTATTGGTTGTATTTCGAGCGAGGATTCAAAGCTCCTTGTTTATGAGTATATGGAGAATCAAAGTCTT...

CDS

Download CDS FASTA

705 bp · TkA01G028170|TK1151|CDS

ATGACCGAGAACAATCTAATCGGTAGTGGTGGTTCAGGGAAAGTGTACAAGATTAAAATCGGTAAAGGTTGTGGTGAGTATGTTGCAGTCAAGACGATTTGGAACCCTAGAAAACTCGATCACGTCCTCGAGAAAGAGTTCTTATCAGAAGTTCATATATTGGGCACAATTCGTCATTCAAACATCGTCAAATTATTGGTTGTATTTCGAGCGAGGATTCAAAGCTCCTTGTTTATGAGTATATGGAGAATCAAAGTCTT...

Protein

Download Protein FASTA

234 aa · TkA01G028170|TK1151|PROTEIN

MTENNLIGSGGSGKVYKIKIGKGCGEYVAVKTIWNPRKLDHVLEKEFLSEVHILGTIRHSNIVKLLVVFRARIQSSLFMSIWRIKVLTNGYMGKRGNHMCLDWPRRLQIAIGAAHGLCYIHHECSPAIIHRDVKSSNILLDSEFKARIADFGFAKILTNSNLGQTNTFFCYAGSFGYFPPGIYFCFFTQSLIYKSFTYTTKNRLILTPILYFFQKIIKFRPIKIDLNLECLKVK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G028170`
TK1151 ID	TkA01G028170
OH-1004 ID	LXL04_005645
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	80.600
Protein coverage (%)	TK1151 76.923 / OH-1004 18.026 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G028170

Location Chr01:7220871-7221575 (-)

Description Similar to HSL1: Receptor-like protein kinase HSL1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g49660`	Receptor kinase involved in the perception of C-terminally encoded plant signaling peptide (CEP) and subsequent regulation of root and shoot development.	XYLEM INTERMIXED WITH PHLOEM1, a leucine-rich repeat receptor-like kinase required for stem growth and vascular development in Arabidopsis thaliana.2012 · DOI: 10.1007/s00425-011-1489-6 CEP5 and XIP1/CEPR1 regulate lateral root initiation in Arabidopsis.2016 · DOI: 10.1093/jxb/erw231
`At5g65710`	Receptor-like serine/threonine-kinase acting on substrates that controls floral organ abscission.	No verified direct reference in this release
`At1g34110`	Together with RGI1, RGI2, RGI3 and RGI4, acts as a receptor of RGF1, a peptide hormone that maintains the postembryonic root stem cell niche by regulating the expression levels and patterns of the transcription factor PLETHORA (PLT).	RGF1 INSENSITIVE 1 to 5, a group of LRR receptor-like kinases, are essential for the perception of root meristem growth factor 1 in Arabidopsis thaliana.2016 · DOI: 10.1038/cr.2016.63
`At3g49670`	LRR-rich receptor-like kinase (LRR-RLK) implicated in the detection of the CLAVATA-family peptides (CLEs), and to the regulation of the triggered signaling required for protophloem differentiation and meristems maintenance through the phosphorylation of CIK proteins (CIKs) and, probably, of PBL34, PBL35 and PBL36.	No verified direct reference in this release
`At5g65700`	LRR-rich receptor-like kinase (LRR-RLK) that, similarly to CLV1 and BAM3, participates in the detection of the CLAVATA-family peptides (e.g. CLE25, CLE26 and CLE45), and to the regulation of the triggered signaling required for protophloem differentiation and meristems maintenance through the phosphorylation of CIK proteins (CIKs) and of PBL34, PBL35 and PBL36.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005645 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0006952 defense response Biological Process

GO:0010067 procambium histogenesis Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0010102 lateral root morphogenesis Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010227 floral organ abscission Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0030154 cell differentiation Biological Process

GO:0045490 pectin catabolic process Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0050829 defense response to Gram-negative bacterium Biological Process

KEGG gene cross-reference

ath:AT1G28440

ath:AT4G28490

ath:AT4G28650

ath:AT5G65710

mtr:11439632

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.460

Rank 1 · TkA01G028170 · TK1151

Nucleus0.291

Rank 2 · TkA01G028170 · TK1151

Cell membrane0.135

Rank 3 · TkA01G028170 · TK1151

Endoplasmic reticulum0.114

Rank 4 · TkA01G028170 · TK1151

Mitochondrion0.109

Rank 5 · TkA01G028170 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase3-180 aa

PF07714PK_Tyr_Ser-Thr4-160 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G028170	`PF00069`	Pkinase	3	180	2.3e-27	96.8
TkA01G028170	`PF07714`	PK_Tyr_Ser-Thr	4	160	1.9e-20	74.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FGL5`	Arabidopsis thaliana	sp\|Q9FGL5\|CEPR1_ARATH Receptor protein-tyrosine kinase CEPR1	42.000%	Swiss-Prot	Medium
`C0LGX3`	Arabidopsis thaliana	sp\|C0LGX3\|HSL2_ARATH LRR receptor-like serine/threonine-protein kinase HSL2	44.400%	Swiss-Prot	Medium
`C0LGF5`	Arabidopsis thaliana	sp\|C0LGF5\|RGI5_ARATH LRR receptor-like serine/threonine-protein kinase RGI5	44.800%	Swiss-Prot	Medium
`Q9M2Z1`	Arabidopsis thaliana	sp\|Q9M2Z1\|BAME2_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM2	44.700%	Swiss-Prot	Medium
`O49545`	Arabidopsis thaliana	sp\|O49545\|BAME1_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM1	44.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card