TkA01G028000 | RubberDandelionOmics

Gene overview

TkA01G028000

Reference: TK1151 Chr: Chr01 Coordinates: 7184377-7188318 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1281 bp · TkA01G028000|TK1151|cDNA

TAAAGCATGATATGCATCTTCTAGCTTTTCCACAAAAGCAAATAAATATTTCATGTGATGGCATTCTTCTTTCTTCTCACTCATTACCTTTAAATTCTCTTCAAGTGCTTTTGTGGGTATAGAGCTCTTTTTAAGTTCATTCCTCTTTGATCAGTTTTAGGTATCACTTGGCAACAATTTCGTTGTCTCTTAAGTTCCTTTTGTTTCTAAATTTCCGACAAATTTATAAGAATTTTAGCCACATATTTCCTTGAAAATAT...

CDS

Download CDS FASTA

654 bp · TkA01G028000|TK1151|CDS

ATGGAGGGATACCCTAAATCGAAGAAGGTGATGATCAAAGAAGCTTGTGAGGAGACAAGGCTTGAACTTAGGCTATGTCCTCCTGGAGATGGCCTTTACTCCATTAGTACAATTCATGCTACTAATAGTTCATCAAAGACGCTCATGTTTAAGAGCTCCACTAAAAGGGTTGCACAGCCACCGGCAGTGGTGGGATGGCCACCGGTGAGATCATCAAGAAAGAACATTATGACATCTAGCAACTACACCAAGGTGGCATC...

Protein

Download Protein FASTA

217 aa · TkA01G028000|TK1151|PROTEIN

MEGYPKSKKVMIKEACEETRLELRLCPPGDGLYSISTIHATNSSSKTLMFKSSTKRVAQPPAVVGWPPVRSSRKNIMTSSNYTKVASFPEKDPIDGSGGNKISSHLETSLYVKINMDGVAIGRKVDLKAYDNYQRLFSAVDELFRGLLAAQGDTSSGTKTETIGLLDGNGEYTLVYEDNEGDRILVGDIPWDMFISSVKRLRMLKTSELSVFCYQDD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G028000`
TK1151 ID	TkA01G028000
OH-1004 ID	LXL04_005648
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G028000

Location Chr01:7184377-7188318 (+)

Description Similar to IAA26: Auxin-responsive protein IAA26

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g16500`	Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations.	No verified direct reference in this release
`At1g51950`	Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0228900`	Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations.	No verified direct reference in this release
`Os05g0523300`	Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations.	No verified direct reference in this release
`Os01g0190300`	Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005648 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0005634 nucleus Cellular Component

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0042802 identical protein binding Molecular Function

KEGG gene cross-reference

ath:AT1G51950

ath:AT3G16500

dosa:Os02g0228900

dosa:Os05g0523300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.893

Rank 1 · TkA01G028000 · TK1151

Cytoplasm0.163

Rank 2 · TkA01G028000 · TK1151

Cell membrane0.058

Rank 3 · TkA01G028000 · TK1151

Endoplasmic reticulum0.029

Rank 4 · TkA01G028000 · TK1151

Plastid0.017

Rank 5 · TkA01G028000 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02309AUX_IAA49-209 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G028000	`PF02309`	AUX_IAA	49	209	1.1e-53	183.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LAL2`	Arabidopsis thaliana	sp\|Q8LAL2\|IAA26_ARATH Auxin-responsive protein IAA26	46.600%	Swiss-Prot	Medium
`O24408`	Arabidopsis thaliana	sp\|O24408\|IAA18_ARATH Auxin-responsive protein IAA18	46.800%	Swiss-Prot	Medium
`Q6H543`	Oryza sativa subsp. japonica	sp\|Q6H543\|IAA7_ORYSJ Auxin-responsive protein IAA7	54.800%	Swiss-Prot	Medium
`Q5W670`	Oryza sativa subsp. japonica	sp\|Q5W670\|IAA18_ORYSJ Auxin-responsive protein IAA18	52.600%	Swiss-Prot	Medium
`Q9LG86`	Oryza sativa subsp. japonica	sp\|Q9LG86\|IAA2_ORYSJ Auxin-responsive protein IAA2	53.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card