TkA01G024300 | RubberDandelionOmics

Gene overview

TkA01G024300

Reference: TK1151 Chr: Chr01 Coordinates: 6254255-6256721 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1171 bp · TkA01G024300|TK1151|cDNA

ATTTTCAAAGCGAAGTGGATGAGCTATGGAAACTGTCCTCTCTCCCTCACATTCTCGCGCCATATCCAACCATCCCAATCTTTCCCTCTTCAGGGACCAAAGTAAGATAAGTTCGTCAAACCACAAGAAATGTTATTCAAACAAGAAATTCGTAGCTTATTACAGTGAATCTTCAGAACCCTCCTCCCAAAATGGATTTTGTAGGAGGGATATTGTTCTATTCGGGTTTGCTGCTTCAGTTGCTACCGTTTTCCCACTCG...

CDS

Download CDS FASTA

888 bp · TkA01G024300|TK1151|CDS

ATGGAAACTGTCCTCTCTCCCTCACATTCTCGCGCCATATCCAACCATCCCAATCTTTCCCTCTTCAGGGACCAAAGTAAGATAAGTTCGTCAAACCACAAGAAATGTTATTCAAACAAGAAATTCGTAGCTTATTACAGTGAATCTTCAGAACCCTCCTCCCAAAATGGATTTTGTAGGAGGGATATTGTTCTATTCGGGTTTGCTGCTTCAGTTGCTACCGTTTTCCCACTCGCAGGATCCGTTGCCGATGAAGAGCT...

Protein

Download Protein FASTA

295 aa · TkA01G024300|TK1151|PROTEIN

METVLSPSHSRAISNHPNLSLFRDQSKISSSNHKKCYSNKKFVAYYSESSEPSSQNGFCRRDIVLFGFAASVATVFPLAGSVADEELKMAPIVDELNAYSYLIPLEMPSKKFSFKWVESRKPERYSSAAPLSPNARLRIVSERVDFIDNLILSITIGPPNPIFLKSNDKSTWEAKDVADSVLSDKSALRVTSSQRMAESSILDAHTSEIDGEPYWYYEYLVRKSPTKTVSDANIFRHYVAASVERDGFLYSLNASTLNKQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G024300`
TK1151 ID	TkA01G024300
OH-1004 ID	LXL04_005668
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G024300

Location Chr01:6254255-6256721 (+)

Description Similar to PPD5: PsbP domain-containing protein 5, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g11450`	Involved in strigolactone biosynthesis.	Developmental defects in mutants of the PsbP domain protein 5 in Arabidopsis thaliana.2011 · DOI: 10.1371/journal.pone.0028624

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005668 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0048564 photosystem I assembly Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009543 chloroplast thylakoid lumen Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0009654 photosystem II oxygen evolving complex Cellular Component

GO:0019898 extrinsic component of membrane Cellular Component

GO:0031977 thylakoid lumen Cellular Component

GO:0005509 calcium ion binding Molecular Function

KEGG gene cross-reference

ath:AT5G11450

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.982

Rank 1 · TkA01G024300 · TK1151

Mitochondrion0.024

Rank 2 · TkA01G024300 · TK1151

Nucleus0.019

Rank 3 · TkA01G024300 · TK1151

Cytoplasm0.014

Rank 4 · TkA01G024300 · TK1151

Cell membrane0.010

Rank 5 · TkA01G024300 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01789PsbP91-107 aa

PF01789PsbP189-276 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G024300	`PF01789`	PsbP	91	107	8.2e-12	46.1
TkA01G024300	`PF01789`	PsbP	189	276	8.2e-12	46.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P82715`	Arabidopsis thaliana	sp\|P82715\|PPD5_ARATH PsbP domain-containing protein 5, chloroplastic	65.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card