TkA01G024020 | RubberDandelionOmics

Gene overview

TkA01G024020

Reference: TK1151 Chr: Chr01 Coordinates: 6193858-6194603 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

627 bp · TkA01G024020|TK1151|cDNA

ATGGGTTCTCAAACACCACTTGAACTTCCAACCATAGATTTTTCCAACATAAAAAACCTCAATCAAGGAACAACCGTATGGGATTCAACGAAAGCCCGAGTGCTAAAAGCATTTCAAGATTACGGTTGTTTTGAAGCATATTTCGATGAGATTTCAGATGATCTTCGAAACTCTGTGTTCGCTTCATTGAAACAGTTGTTTGATCTCCCTTTAGAAACAAAGTTACAAAACATCCCCGACAAATTCTTCAATGGTTACAT...

CDS

Download CDS FASTA

627 bp · TkA01G024020|TK1151|CDS

ATGGGTTCTCAAACACCACTTGAACTTCCAACCATAGATTTTTCCAACATAAAAAACCTCAATCAAGGAACAACCGTATGGGATTCAACGAAAGCCCGAGTGCTAAAAGCATTTCAAGATTACGGTTGTTTTGAAGCATATTTCGATGAGATTTCAGATGATCTTCGAAACTCTGTGTTCGCTTCATTGAAACAGTTGTTTGATCTCCCTTTAGAAACAAAGTTACAAAACATCCCCGACAAATTCTTCAATGGTTACAT...

Protein

Download Protein FASTA

208 aa · TkA01G024020|TK1151|PROTEIN

MGSQTPLELPTIDFSNIKNLNQGTTVWDSTKARVLKAFQDYGCFEAYFDEISDDLRNSVFASLKQLFDLPLETKLQNIPDKFFNGYIGQNKDVPLYESLGIEDTRSFTHLMWPHGNPEFCNSIQSYIEKLTQLDQTVRMMILGSLNLDKYLDEHMELTSYVLRVMSYRAPEKHESSVGLKAHADKNMMTILHQNEVGGLEVQMEMKNG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G024020`
TK1151 ID	TkA01G024020
OH-1004 ID	LXL04_005676
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.500
Protein coverage (%)	TK1151 97.115 / OH-1004 60.479 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G024020

Location Chr01:6193858-6194603 (+)

Description Similar to AOP1.2: Probable 2-oxoglutarate-dependent dioxygenase AOP1.2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q945B6`	Probable 2-oxoglutarate-dependent dioxygenase that may be involved in glucosinolates biosynthesis.	No verified direct reference in this release
`UniProt: Q944Z5`	Probable 2-oxoglutarate-dependent dioxygenase that may be involved in glucosinolates biosynthesis.	No verified direct reference in this release
`At4g03070`	Probable 2-oxoglutarate-dependent dioxygenase that may be involved in glucosinolates biosynthesis.	No verified direct reference in this release
`At1g80330`	Converts the inactive gibberellin (GA) precursors GA9 and GA20 in the bioactives gibberellins GA4 and GA1.	Purification and kinetic studies of recombinant gibberellin dioxygenases.2005 · DOI: 10.1186/1471-2229-5-19 Distinct and overlapping roles of two gibberellin 3-oxidases in Arabidopsis development.2006 · DOI: 10.1111/j.1365-313x.2005.02642.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005676 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009611 response to wounding Biological Process

GO:0009699 phenylpropanoid biosynthetic process Biological Process

GO:0019761 glucosinolate biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0016706 2-oxoglutarate-dependent dioxygenase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0051213 dioxygenase activity Molecular Function

KEGG gene cross-reference

ag:ALG05135

ath:AT4G03070

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.837

Rank 1 · TkA01G024020 · TK1151

Nucleus0.405

Rank 2 · TkA01G024020 · TK1151

Endoplasmic reticulum0.044

Rank 3 · TkA01G024020 · TK1151

Cell membrane0.025

Rank 4 · TkA01G024020 · TK1151

Mitochondrion0.024

Rank 5 · TkA01G024020 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14226DIOX_N9-90 aa

PF31044DUF8784146-196 aa

PF031712OG-FeII_Oxy164-203 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G024020	`PF14226`	DIOX_N	9	90	5.4e-11	43.9
TkA01G024020	`PF31044`	DUF8784	146	196	0.17	12.3
TkA01G024020	`PF03171`	2OG-FeII_Oxy	164	203	1e-05	26.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q945B6`	Arabidopsis thaliana	sp\|Q945B6\|AOP1L_ARATH Probable 2-oxoglutarate-dependent dioxygenase AOP1.2	46.100%	Swiss-Prot	Medium
`Q944Z5`	Arabidopsis thaliana	sp\|Q944Z5\|AOP1V_ARATH Probable 2-oxoglutarate-dependent dioxygenase AOP1 (Fragment)	46.300%	Swiss-Prot	Medium
`Q9ZTA3`	Arabidopsis thaliana	sp\|Q9ZTA3\|AOP1C_ARATH Probable 2-oxoglutarate-dependent dioxygenase AOP1	45.400%	Swiss-Prot	Medium
`Q9C971`	Arabidopsis thaliana	sp\|Q9C971\|G3OX4_ARATH Gibberellin 3-beta-dioxygenase 4	28.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card