TkA01G023930 | RubberDandelionOmics

Gene overview

TkA01G023930

Reference: TK1151 Chr: Chr01 Coordinates: 6175219-6176892 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1451 bp · TkA01G023930|TK1151|cDNA

CCAAGTCTCCTCCTCTATAAAAGGCGGAACACCCGTTGCTCTTCTTCAGTCCTCATAAAACCTACACATATTCTGTTAATCTCCAACTACCTTCTTTCACTCATGGAGTTCCTCTACTTCTTATCCTTTATTTCTTTGGCAATGGTTGTGAGCCATGCAGCTGACGTGGCTCCTGAAACATACTGGAAATCTGTGTTGCCAAACACTCCCATGCCCAAAGCCTTCACCAATCTCCTTCAAACCGATAAGAGCACCGATGT...

CDS

Download CDS FASTA

1257 bp · TkA01G023930|TK1151|CDS

CCAAGTCTCCTCCTCTATAAAAGGCGGAACACCCGTTGCTCTTCTTCAGTCCTCATAAAACCTACACATATTCTGTTAATCTCCAACTACCTTCTTTCACTCATGGAGTTCCTCTACTTCTTATCCTTTATTTCTTTGGCAATGGTTGTGAGCCATGCAGCTGACGTGGCTCCTGAAACATACTGGAAATCTGTGTTGCCAAACACTCCCATGCCCAAAGCCTTCACCAATCTCCTTCAAACCGATAAGAGCACCGATGT...

Protein

Download Protein FASTA

418 aa · TkA01G023930|TK1151|PROTEIN

PSLLLYKRRNTRCSSSVLIKPTHILLISNYLLSLMEFLYFLSFISLAMVVSHAADVAPETYWKSVLPNTPMPKAFTNLLQTDKSTDVHVGVGKGGVSVHAPGTNVGVGKGGVSVHAPGTNVGVGKGGVSVHAPGTTVGVGKGGGHVSVHSPKSKPKGKCDNVYVGKGRIIVRCHDKGKRTHVEVSPFSYKYAATDDQLKDDPNVALFFLQKDLHDGNSMNLHFTDITTTPSSNFLPRKVADAIPFSSEKLPELYTRFTVK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G023930`
TK1151 ID	TkA01G023930
OH-1004 ID	LXL04_005680
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	91.400
Protein coverage (%)	TK1151 91.866 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G023930

Location Chr01:6175219-6176892 (-)

Description Similar to RD22: BURP domain protein RD22

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g25610`	Acts to suppress chlorophyll degradation under moisture stress.	AtRD22 and AtUSPL1, members of the plant-specific BURP domain family involved in Arabidopsis thaliana drought tolerance.2014 · DOI: 10.1371/journal.pone.0110065

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0733500`	BURP domain-containing protein 3.	No verified direct reference in this release
`Os11g0170900`	BURP domain-containing protein 17.	No verified direct reference in this release
`Os04g0225700`	BURP domain-containing protein 5.	No verified direct reference in this release
`Os05g0215066`	BURP domain-containing protein 6.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005680 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009555 pollen development Biological Process

GO:0009651 response to salt stress Biological Process

GO:0010152 pollen maturation Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0043668 exine Cellular Component

GO:0070645 Ubisch body Cellular Component

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT5G25610

dosa:Os04g0225700

dosa:Os11g0170900

osa:4335212

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.397

Rank 1 · TkA01G023930 · TK1151

Extracellular0.350

Rank 2 · TkA01G023930 · TK1151

Cytoplasm0.173

Rank 3 · TkA01G023930 · TK1151

Endoplasmic reticulum0.166

Rank 4 · TkA01G023930 · TK1151

Cell membrane0.092

Rank 5 · TkA01G023930 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10950Organ_specific59-84 aa

PF03181BURP206-417 aa

PF10950Organ_specific267-297 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G023930	`PF10950`	Organ_specific	59	84	0.01	17.3
TkA01G023930	`PF03181`	BURP	206	417	8.9e-86	287.6
TkA01G023930	`PF10950`	Organ_specific	267	297	0.01	17.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q08298`	Arabidopsis thaliana	sp\|Q08298\|RD22_ARATH BURP domain protein RD22	52.900%	Swiss-Prot	High
`Q942D4`	Oryza sativa subsp. japonica	sp\|Q942D4\|BURP3_ORYSJ BURP domain-containing protein 3	57.700%	Swiss-Prot	Medium
`B9G9L9`	Oryza sativa subsp. japonica	sp\|B9G9L9\|BURPH_ORYSJ BURP domain-containing protein 17	52.900%	Swiss-Prot	Medium
`Q0JEP3`	Oryza sativa subsp. japonica	sp\|Q0JEP3\|BURP5_ORYSJ BURP domain-containing protein 5	48.200%	Swiss-Prot	Medium
`Q6I5B2`	Oryza sativa subsp. japonica	sp\|Q6I5B2\|BURP6_ORYSJ BURP domain-containing protein 6	44.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card