RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G023520
Reference: TK1151 Chr: Chr01 Coordinates: 6045074-6046081 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

926 bp · TkA01G023520|TK1151|cDNA

CCAGACTATCCTTCTAAATTCATTCCACGATCAATCAAATCCCTAATAGTTTGCCCAATTCAATGTTAGGTTACAGTTACATCTCAATTGCTGAAGAAAATCGTTCTGATCGAAGTTTGGGGGTTGTTGAAGGAAATGAAGATGTCAATTCGAATGAATTCGAGGTGGATTTCGTGTCGGAATTAGGTTTTCATGTAGAAAATCAGGATAACCATAACCTTAATGGTGTCGATGGTGATTATTCTGGGTTTACGATTGCG...

CDS

Download CDS FASTA

705 bp · TkA01G023520|TK1151|CDS

ATGTTAGGTTACAGTTACATCTCAATTGCTGAAGAAAATCGTTCTGATCGAAGTTTGGGGGTTGTTGAAGGAAATGAAGATGTCAATTCGAATGAATTCGAGGTGGATTTCGTGTCGGAATTAGGTTTTCATGTAGAAAATCAGGATAACCATAACCTTAATGGTGTCGATGGTGATTATTCTGGGTTTACGATTGCGGAGACTGGGGATGAGTTCCTTGTGTCCAGACGGAGAATGGATCGCCATGCTGCTCGATCTGA...

Protein

Download Protein FASTA

234 aa · TkA01G023520|TK1151|PROTEIN

MLGYSYISIAEENRSDRSLGVVEGNEDVNSNEFEVDFVSELGFHVENQDNHNLNGVDGDYSGFTIAETGDEFLVSRRRMDRHAARSESSRSSIDSGAPGFFMGGLTVTDMAEDGPAMDRDCDDETSLHLCWDAFHLDDDNTTPNTNSNVNGDFDWEEVDERIDGRELSMFFDAEADDDASVLPGIPPVNQEPVEAEDRDGLEWEVLLNVQNFEPNPDLSGHLLQKQQSRIFQLS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G023520
TK1151 IDTkA01G023520
OH-1004 IDLXL04_005694
Relationship / confidenceRbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)99.100
Protein coverage (%)TK1151 94.017 / OH-1004 66.066
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G023520
LocationChr01:6045074-6046081 (+)
DescriptionSimilar to RING1: E3 ubiquitin-protein ligase RING1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_005694 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006511 ubiquitin-dependent protein catabolic process Biological Process
GO:0009651 response to salt stress Biological Process
GO:0009737 response to abscisic acid Biological Process
GO:0009738 abscisic acid-activated signaling pathway Biological Process
GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process
GO:0009938 negative regulation of gibberellic acid mediated signaling pathway Biological Process
GO:0016567 protein ubiquitination Biological Process
GO:0090378 seed trichome elongation Biological Process
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0005829 cytosol Cellular Component
GO:0009505 plant-type cell wall Cellular Component
KEGG gene cross-reference
ath:AT2G40830
ath:AT3G19950
ath:AT5G20910
ath:AT5G64920
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.520
Rank 1 · TkA01G023520 · TK1151
Nucleus0.493
Rank 2 · TkA01G023520 · TK1151
Cell membrane0.095
Rank 3 · TkA01G023520 · TK1151
Endoplasmic reticulum0.055
Rank 4 · TkA01G023520 · TK1151
Mitochondrion0.050
Rank 5 · TkA01G023520 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser