TkA01G022410 | RubberDandelionOmics

Gene overview

TkA01G022410

Reference: TK1151 Chr: Chr01 Coordinates: 5735894-5738364 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

624 bp · TkA01G022410|TK1151|cDNA

ATGTTTCCTCTTCCGCTTCTTATAAGCCCTAGACTGAAGACTCCGATTTCGAGTGAGAGGGTGGGTTCCGATTTCGAGTGGGTTCCTTCATCTCCTCGCAGCCCCTTCAATTGCAACCTCCGCGAACCCATTCCCTCAGCCTCCTCCGCTGCCGCCTCCGCCTGCCCTTTCTACTTCGGCTCCGGTGGATGTGTAGATGCTGTATCAGCAGCAATTGAAACCTTGGAGAATGATCCATGCACAAATGCTGGAAGAGGTTC...

CDS

Download CDS FASTA

624 bp · TkA01G022410|TK1151|CDS

ATGTTTCCTCTTCCGCTTCTTATAAGCCCTAGACTGAAGACTCCGATTTCGAGTGAGAGGGTGGGTTCCGATTTCGAGTGGGTTCCTTCATCTCCTCGCAGCCCCTTCAATTGCAACCTCCGCGAACCCATTCCCTCAGCCTCCTCCGCTGCCGCCTCCGCCTGCCCTTTCTACTTCGGCTCCGGTGGATGTGTAGATGCTGTATCAGCAGCAATTGAAACCTTGGAGAATGATCCATGCACAAATGCTGGAAGAGGTTC...

Protein

Download Protein FASTA

207 aa · TkA01G022410|TK1151|PROTEIN

MFPLPLLISPRLKTPISSERVGSDFEWVPSSPRSPFNCNLREPIPSASSAAASACPFYFGSGGCVDAVSAAIETLENDPCTNAGRGSNLTEDVHVECDASVMDGKSGTFGAVGAVPEKLCNWDKWTSQAGAKWTKIHPQQQQPNKRESDNSSSSAAAQGQNGQKQPPRMSSKNRKEPNNSSNTAGPPSTQDRGRKAKNYLQKLPPFL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G022410`
TK1151 ID	TkA01G022410
OH-1004 ID	LXL04_002052
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	87.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G022410

Location Chr01:5735894-5738364 (+)

Description Similar to At4g00590: Putative threonine aspartase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g00590`	Putative threonine aspartase.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002052 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0033345 L-asparagine catabolic process via L-aspartate Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0051604 protein maturation Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004067 asparaginase activity Molecular Function

GO:0004298 threonine-type endopeptidase activity Molecular Function

GO:0008798 beta-aspartyl-peptidase activity Molecular Function

GO:0042802 identical protein binding Molecular Function

KEGG gene cross-reference

ath:AT4G00590

hsa:55617

mcf:101866084

mmu:75812

rno:246307

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.409

Rank 1 · TkA01G022410 · TK1151

Cytoplasm0.358

Rank 2 · TkA01G022410 · TK1151

Mitochondrion0.160

Rank 3 · TkA01G022410 · TK1151

Cell membrane0.080

Rank 4 · TkA01G022410 · TK1151

Plastid0.063

Rank 5 · TkA01G022410 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01112Asparaginase_261-115 aa

PF25590DUF793687-157 aa

PF01112Asparaginase_2152-152 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G022410	`PF01112`	Asparaginase_2	61	115	3.3e-14	53.5
TkA01G022410	`PF25590`	DUF7936	87	157	0.12	13.8
TkA01G022410	`PF01112`	Asparaginase_2	152	152	3.3e-14	53.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O65268`	Arabidopsis thaliana	sp\|O65268\|TASP1_ARATH Putative threonine aspartase	80.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card