TkA01G021400 | RubberDandelionOmics

Gene overview

TkA01G021400

Reference: TK1151 Chr: Chr01 Coordinates: 5535492-5538095 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1446 bp · TkA01G021400|TK1151|cDNA

ATGGATGCTATTCGGTTGGAGGCACCTTTTTCGGAAAAGGAGGTTAAGGATGCGGTTTGGGCGTGTGGGAGTGATAGGGCCCCGGGTCCTGATGGGTTCACTTTTAAATTCCTGAAGTCCTTCTGGAACATTTTATCCCCCGATATCATGCGTTTTGTTAAACATTTTGAGGACCATAGATATATCTCCAAAGACTGCAGGAGTATTCTTGATGGACCTCTCATAGTCAACGAGCTTGACTCGGTCCAACTCCAAATGGG...

CDS

Download CDS FASTA

1446 bp · TkA01G021400|TK1151|CDS

ATGGATGCTATTCGGTTGGAGGCACCTTTTTCGGAAAAGGAGGTTAAGGATGCGGTTTGGGCGTGTGGGAGTGATAGGGCCCCGGGTCCTGATGGGTTCACTTTTAAATTCCTGAAGTCCTTCTGGAACATTTTATCCCCCGATATCATGCGTTTTGTTAAACATTTTGAGGACCATAGATATATCTCCAAAGACTGCAGGAGTATTCTTGATGGACCTCTCATAGTCAACGAGCTTGACTCGGTCCAACTCCAAATGGG...

Protein

Download Protein FASTA

481 aa · TkA01G021400|TK1151|PROTEIN

MDAIRLEAPFSEKEVKDAVWACGSDRAPGPDGFTFKFLKSFWNILSPDIMRFVKHFEDHRYISKDCRSILDGPLIVNELDSVQLQMGFRNKWRNWIRGCLSSARASLIINGCPSEEFNVSRGFRQGKRVGIPFSTGFGINFLCAKSQTLSFGGRLTLIKSVLGNLPTFYLSLFKAPRGVLESLQQLRRRFLWGGSDDKRKIHLVSWDKVIAPKKKGGLGVGSIRALNMGLMVKWWWRLKKSPDSLWSKVISSIHSTQGKP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G021400`
TK1151 ID	TkA01G021400
OH-1004 ID	LXL04_016670
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	30.900
Protein coverage (%)	TK1151 75.676 / OH-1004 30.070 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G021400`
Location	Chr01:5535492-5538095 (+)
Description	Similar to RHM1: Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_016670` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009225 nucleotide-sugar metabolic process Biological Process GO:0010192 mucilage biosynthetic process Biological Process GO:0010214 seed coat development Biological Process GO:0010253 UDP-rhamnose biosynthetic process Biological Process GO:0010315 auxin export across the plasma membrane Biological Process GO:0019300 rhamnose biosynthetic process Biological Process GO:0019305 dTDP-rhamnose biosynthetic process Biological Process GO:0030154 cell differentiation Biological Process GO:0042127 regulation of cell population proliferation Biological Process GO:0051555 flavonol biosynthetic process Biological Process GO:0071555 cell wall organization Biological Process GO:0005634 nucleus Cellular Component
KEGG gene cross-reference	ath:AT1G53500 ath:AT1G63000 ath:AT1G78570 ath:AT3G14790 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.444

Rank 1 · TkA01G021400 · TK1151

Nucleus0.411

Rank 2 · TkA01G021400 · TK1151

Cell membrane0.096

Rank 3 · TkA01G021400 · TK1151

Plastid0.066

Rank 4 · TkA01G021400 · TK1151

Endoplasmic reticulum0.062

Rank 5 · TkA01G021400 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13966zf-RVT335-370 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G021400	`PF13966`	zf-RVT	335	370	0.00074	20.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card