Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1718 bp · TkA01G020380|TK1151|cDNA
ACGATTCCAAAAATTAATATGCAGAAGTTCTAATTAGGGGTCTTTTTTAGCCAATTTTAAAATCTCACAACAAATTTAATAACAAATTTTAAAATTAATTAAAAACTTATTAATCGATAAAATCGTCATATTTTATCGTACCTTTCTGTCTCTCACTCCAGTGCTCACGCTTACCGACTTTGCCTCGCCGACGAAGCTGCTGCTTGCTGCCGCCTCTAATTTTTGAGATATATAAGTCTTTGCAATTGTCCCTGGACGTT...
1743 bp · TkA01G020380|TK1151|CDS
ATGGCGGATTCAATCATTACTTCAGAGGCACCAACAAATTCATCCCAACTGAACCCTCCATCCCGTATTATCTGCCGTGTATGTCAAAAACAATTTTCACAATACACATGCCCTCGATGTAATACTCGTTATTGTTCCCTTCCATGTTACAAGTCACACAGTAACCGATGCACAGAATCATTTATGAGAGACAATGTTATGGGAGAAATGCAGCAAATGGGACCCGATGATGACACCAAACAGAAAATGCTTGACATTTT...
Protein
Download Protein FASTA580 aa · TkA01G020380|TK1151|PROTEIN
MADSIITSEAPTNSSQLNPPSRIICRVCQKQFSQYTCPRCNTRYCSLPCYKSHSNRCTESFMRDNVMGEMQQMGPDDDTKQKMLDILKRFHSEEEEEEADTVEDDDNDFTESSLSEETIQKIMSGLQDADLCTEILSAHGWDLELAISSITSTSEEDHINHPTTSAVDNDNHNDAIATDRFEQSGFIATEGAGPTGLAWKLITLPISIVSGSLGLVSGAVGLGLWAVGGVLSYSLSMIGLTNSGSNNGASSSTPLVSLST...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G020380 |
|---|---|
| TK1151 ID | TkA01G020380 |
| OH-1004 ID | LXL04_031873 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 36.700 |
| Protein coverage (%) | TK1151 53.621 / OH-1004 80.060Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G020380 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:5233890-5245783 (+) | |||||||||
| Description | Similar to PUX10: Plant UBX domain-containing protein 10 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006986 response to unfolded protein Biological Process GO:0030970 retrograde protein transport, ER to cytosol Biological Process GO:0034389 lipid droplet organization Biological Process GO:0035617 stress granule disassembly Biological Process GO:0036503 ERAD pathway Biological Process GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process GO:1905691 lipid droplet disassembly Biological Process GO:0005576 extracellular region Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005811 lipid droplet Cellular Component GO:0005886 plasma membrane Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT4G10790 bta:767948 hsa:23197 xla:443943 xtr:734096 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF04438zf-HIT22-51 aaPF12939DUF383760-98 aaPF29346GAP4591-176 aaPF14555UBA_4128-149 aaPF22566UBA_8129-149 aaPF28552UBA_OTUD7A_B131-151 aaPF21021FAF1268-344 aaPF12939DUF3837378-401 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G020380 | PF04438 | zf-HIT | 22 | 51 | 3.4e-11 | 43.4 |
| TkA01G020380 | PF12939 | DUF3837 | 60 | 98 | 2.4 | 9.3 |
| TkA01G020380 | PF29346 | GAP45 | 91 | 176 | 0.16 | 12.8 |
| TkA01G020380 | PF14555 | UBA_4 | 128 | 149 | 7.8e-05 | 23.1 |
| TkA01G020380 | PF22566 | UBA_8 | 129 | 149 | 0.12 | 12.9 |
| TkA01G020380 | PF28552 | UBA_OTUD7A_B | 131 | 151 | 0.029 | 14.7 |
| TkA01G020380 | PF21021 | FAF1 | 268 | 344 | 1.5e-10 | 41.7 |
| TkA01G020380 | PF12939 | DUF3837 | 378 | 401 | 2.4 | 9.3 |
| TkA01G020380 | PF29346 | GAP45 | 409 | 489 | 0.16 | 12.8 |
| TkA01G020380 | PF00582 | Usp | 428 | 481 | 4.3 | 8.6 |
| TkA01G020380 | PF12939 | DUF3837 | 440 | 440 | 2.4 | 9.3 |
| TkA01G020380 | PF12939 | DUF3837 | 478 | 492 | 2.4 | 9.3 |
| TkA01G020380 | PF00789 | UBX | 497 | 575 | 6.3e-22 | 78.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.