Gene Card
Gene overview
cDNA / CDS / Protein Sequences
537 bp · TkA01G017760|TK1151|cDNA
ATGTCTGATTTTGAAGACACTGGAGAAACAGGTGCTGCTGCTCCTCCGGTTAGAATCAACGAGGTGAAGCCTGAGACCGCCGAGAAGTCCGATCGTGGACTGTTTGATGTTTTTGGGAAGAAAGACGCAGAGAAGAAATGCGAAGAGGCAGCGATCTCATCGGAGTTTGAAGAGAAAGTTCAGGTCTCCGAACCCGTACCGGAGGAAAAGAAGGAGAGTTTGCCCGCCAAACTTCACAGATCCGGCGAAGAGTGTGATGA...
537 bp · TkA01G017760|TK1151|CDS
ATGTCTGATTTTGAAGACACTGGAGAAACAGGTGCTGCTGCTCCTCCGGTTAGAATCAACGAGGTGAAGCCTGAGACCGCCGAGAAGTCCGATCGTGGACTGTTTGATGTTTTTGGGAAGAAAGACGCAGAGAAGAAATGCGAAGAGGCAGCGATCTCATCGGAGTTTGAAGAGAAAGTTCAGGTCTCCGAACCCGTACCGGAGGAAAAGAAGGAGAGTTTGCCCGCCAAACTTCACAGATCCGGCGAAGAGTGTGATGA...
Protein
Download Protein FASTA178 aa · TkA01G017760|TK1151|PROTEIN
MSDFEDTGETGAAAPPVRINEVKPETAEKSDRGLFDVFGKKDAEKKCEEAAISSEFEEKVQVSEPVPEEKKESLPAKLHRSGEECDENGEEKKNWAHDRQSEVEGFTSRSTGVYSGGGGSGSSGSSSRGRRDGKGRRTRPGKKNEDDRKNGRVLTLAGLRVVLMGDPFWIRVISGPGF
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G017760 |
|---|---|
| TK1151 ID | TkA01G017760 |
| OH-1004 ID | LXL04_022257 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 85.500 |
| Protein coverage (%) | TK1151 34.831 / OH-1004 28.837Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G017760 |
|---|---|
| Location | Chr01:4528530-4529066 (-) |
| Description | Similar to ECPP44: Phosphoprotein ECPP44 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006970 response to osmotic stress Biological Process GO:0009269 response to desiccation Biological Process GO:0009408 response to heat Biological Process GO:0009409 response to cold Biological Process GO:0009414 response to water deprivation Biological Process GO:0009631 cold acclimation Biological Process GO:0009737 response to abscisic acid Biological Process GO:0009992 intracellular water homeostasis Biological Process GO:0010029 regulation of seed germination Biological Process GO:0010286 heat acclimation Biological Process GO:0050821 protein stabilization Biological Process GO:0050832 defense response to fungus Biological Process |
| KEGG gene cross-reference | ath:AT1G20440 ath:AT1G20450 ath:AT1G76180 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.