TkA01G017570 | RubberDandelionOmics

Gene overview

TkA01G017570

Reference: TK1151 Chr: Chr01 Coordinates: 4493049-4493866 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

342 bp · TkA01G017570|TK1151|cDNA

CTCAGGGGCCATCTCCGTCGGTTTACCTCGTCTTCCTACAACCACCGCTGTCCGTTGTTCCGCGTTACCACACCTTCCAGCTCGTTCGTTTTCCCCCTTCCATCAAACAGGTTTCAGTGTCGCGAAGATCATCTGTGTGTTCCAGACCAGGCCTCAGAAGATGCATCATCTGCTCCTATGCTAATGAGTTGTTCAACGACTTTGAAGGAAAAGTGGGACGCACTTGAAAACAAGTCGACAGTTATAGTATATGGAGGAGC...

CDS

Download CDS FASTA

303 bp · TkA01G017570|TK1151|CDS

CTCAGGGGCCATCTCCGTCGGTTTACCTCGTCTTCCTACAACCACCGCTGTCCGTTGTTCCGCGTTACCACACCTTCCAGCTCGTTCGTTTTCCCCCTTCCATCAAACAGGTTTCAGTGTCGCGAAGATCATCTGTGTGTTCCAGACCAGGCCTCAGAAGATGCATCATCTGCTCCTATGCTAATGAGTTGTTCAACGACTTTGAAGGAAAAGTGGGACGCACTTGAAAACAAGTCGACAGTTATAGTATATGGAGGAGC...

Protein

Download Protein FASTA

100 aa · TkA01G017570|TK1151|PROTEIN

LRGHLRRFTSSSYNHRCPLFRVTTPSSSFVFPLPSNRFQCREDHLCVPDQASEDASSAPMLMSCSTTLKEKWDALENKSTVIVYGGAVVAFGYLQSLSVL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G017570`
TK1151 ID	TkA01G017570
OH-1004 ID	LXL04_027177
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	63.000
Protein coverage (%)	TK1151 83.000 / OH-1004 40.271 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G017570

Location Chr01:4493049-4493866 (-)

Description Similar to CURT1A: Protein CURVATURE THYLAKOID 1A, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g01150`	Determines thylakoid architecture by inducing membrane curvature.	Arabidopsis CURVATURE THYLAKOID1 proteins modify thylakoid architecture by inducing membrane curvature.2013 · DOI: 10.1105/tpc.113.113118

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027177 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0090391 granum assembly Biological Process

GO:0097753 membrane bending Biological Process

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009515 granal stacked thylakoid Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0010287 plastoglobule Cellular Component

KEGG gene cross-reference

ath:AT4G01150

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.674

Rank 1 · TkA01G017570 · TK1151

Mitochondrion0.198

Rank 2 · TkA01G017570 · TK1151

Nucleus0.082

Rank 3 · TkA01G017570 · TK1151

Cytoplasm0.061

Rank 4 · TkA01G017570 · TK1151

Endoplasmic reticulum0.020

Rank 5 · TkA01G017570 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06617M-inducer_phosp28-83 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G017570	`PF06617`	M-inducer_phosp	28	83	0.12	12.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O04616`	Arabidopsis thaliana	sp\|O04616\|CUT1A_ARATH Protein CURVATURE THYLAKOID 1A, chloroplastic	38.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card