TkA01G016310 | RubberDandelionOmics

Gene overview

TkA01G016310

Reference: TK1151 Chr: Chr01 Coordinates: 4158900-4159322 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

423 bp · TkA01G016310|TK1151|cDNA

ATGGGTAAGTTCTTGAGTCTTCTTTTTATCATCTTGATATCGAATCTCGCCGGATTAAATGCTCAATCTTGCGAAACTGCCGCCTTTCGAACTCGCATCTTTACCGGTTCTGAACTCGCACCTGCGTCTCTTTACCGGTTCCGAACTCGCATCTTCACTAGAACTACAACACCAACGACACCGTCGACTTGGCTTTCCGGCACGCCGGATCAGCCACATCTCAATGGGATCAGCCACGGTTCAGTTGAAGCTTACACTAC...

CDS

Download CDS FASTA

423 bp · TkA01G016310|TK1151|CDS

ATGGGTAAGTTCTTGAGTCTTCTTTTTATCATCTTGATATCGAATCTCGCCGGATTAAATGCTCAATCTTGCGAAACTGCCGCCTTTCGAACTCGCATCTTTACCGGTTCTGAACTCGCACCTGCGTCTCTTTACCGGTTCCGAACTCGCATCTTCACTAGAACTACAACACCAACGACACCGTCGACTTGGCTTTCCGGCACGCCGGATCAGCCACATCTCAATGGGATCAGCCACGGTTCAGTTGAAGCTTACACTAC...

Protein

Download Protein FASTA

140 aa · TkA01G016310|TK1151|PROTEIN

MGKFLSLLFIILISNLAGLNAQSCETAAFRTRIFTGSELAPASLYRFRTRIFTRTTTPTTPSTWLSGTPDQPHLNGISHGSVEAYTTSVTGFQTTLQLSRLSFDMPTITAERVNGVVVIYATIVLPSGEDELAGNPSIID

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G016310`
TK1151 ID	TkA01G016310
OH-1004 ID	LXL04_038010
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	59.600
Protein coverage (%)	TK1151 91.429 / OH-1004 38.021 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G016310`
Location	Chr01:4158900-4159322 (-)
Description	Similar to At5g35735: Cytochrome b561 and DOMON domain-containing protein At5g35735
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_038010` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0016036 cellular response to phosphate starvation Biological Process GO:0071456 cellular response to hypoxia Biological Process GO:0080022 primary root development Biological Process GO:0005576 extracellular region Cellular Component GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009506 plasmodesma Cellular Component GO:0009507 chloroplast Cellular Component GO:0016020 membrane Cellular Component GO:0000293 ferric-chelate reductase activity Molecular Function GO:0009055 electron transfer activity Molecular Function GO:0046872 metal ion binding Molecular Function
KEGG gene cross-reference	ath:AT3G25290 ath:AT4G12980 ath:AT4G17280 ath:AT5G35735 ath:AT5G47530 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.597

Rank 1 · TkA01G016310 · TK1151

Endoplasmic reticulum0.149

Rank 2 · TkA01G016310 · TK1151

Cytoplasm0.132

Rank 3 · TkA01G016310 · TK1151

Lysosome / Vacuole0.061

Rank 4 · TkA01G016310 · TK1151

Cell membrane0.055

Rank 5 · TkA01G016310 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12607DUF377246-72 aa

PF04526DUF56879-128 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G016310	`PF12607`	DUF3772	46	72	0.18	12.2
TkA01G016310	`PF04526`	DUF568	79	128	0.0015	20.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card