TkA01G016200 | RubberDandelionOmics

Gene overview

TkA01G016200

Reference: TK1151 Chr: Chr01 Coordinates: 4132551-4134180 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

898 bp · TkA01G016200|TK1151|cDNA

ACCGTAAGCTTCCTCCGAATTTTCAGAAAAAAGTAGACTCTAATAATCAGAGGCGAGGATCTTCGAGGATTTCCTGGTGGCGGTAAAGGATGGCTTCGAAGCGGATCTTGAAAGAACTCAAGGATCTTCAGAAAGATCCTCCTACCTCTTGCAGCGCAGGCCCAGTGGCAGAAGACATGTTTCACTGGCAAGCTACAATTATGGGTCCTCCTGACAGTCCTTATGCTGGTGGAGTCTTTCTAGTCACCATTCATTTCCCT...

CDS

Download CDS FASTA

447 bp · TkA01G016200|TK1151|CDS

ATGGCTTCGAAGCGGATCTTGAAAGAACTCAAGGATCTTCAGAAAGATCCTCCTACCTCTTGCAGCGCAGGCCCAGTGGCAGAAGACATGTTTCACTGGCAAGCTACAATTATGGGTCCTCCTGACAGTCCTTATGCTGGTGGAGTCTTTCTAGTCACCATTCATTTCCCTCCAGATTATCCATTCAAGCCACCAAAGGTAGCTTTCAGGACAAAGGTCTTCCACCCAAACATCAACAGCAATGGTAGCATCTGTCTTGA...

Protein

Download Protein FASTA

148 aa · TkA01G016200|TK1151|PROTEIN

MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDRNKYETTARSWTQKYAMG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G016200`
TK1151 ID	TkA01G016200
OH-1004 ID	LXL04_005796
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G016200

Location Chr01:4132551-4134180 (-)

Description Similar to UBC10: Ubiquitin-conjugating enzyme E2 10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g53300`	Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins.	No verified direct reference in this release
`At4g27960`	Accepts the ubiquitin-like protein SUMO/SMT3 from the E1 complex and catalyzes its covalent attachment to other proteins.	No verified direct reference in this release
`At1g64230`	Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0261100`	E2 conjugating enzyme that associates with the E3 ubiquitin- protein ligase EL5 to mediate ubiquitination of target proteins.	EL5, a rice N-acetylchitooligosaccharide elicitor-responsive RING-H2 finger protein, is a ubiquitin ligase which functions in vitro in co-operation with an elicitor-responsive ubiquitin-conjugating enzyme, OsUBC5b.2002 · DOI: 10.1046/j.1365-313x.2002.01299.x

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005796 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000209 protein polyubiquitination Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0016925 protein sumoylation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004842 ubiquitin-protein transferase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0031625 ubiquitin protein ligase binding Molecular Function

GO:0061631 ubiquitin conjugating enzyme activity Molecular Function

KEGG gene cross-reference

ath:AT1G64230

ath:AT4G27960

ath:AT5G53300

dosa:Os02g0261100

sly:100301932

sly:101249087

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.593

Rank 1 · TkA01G016200 · TK1151

Nucleus0.549

Rank 2 · TkA01G016200 · TK1151

Cell membrane0.096

Rank 3 · TkA01G016200 · TK1151

Mitochondrion0.083

Rank 4 · TkA01G016200 · TK1151

Endoplasmic reticulum0.072

Rank 5 · TkA01G016200 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00179UQ_con5-141 aa

PF05773RWD50-109 aa

PF05743UEV52-115 aa

PF00631G-gamma95-137 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G016200	`PF00179`	UQ_con	5	141	3.7e-55	186.1
TkA01G016200	`PF05773`	RWD	50	109	0.0009	20.1
TkA01G016200	`PF05743`	UEV	52	115	0.049	14.0
TkA01G016200	`PF00631`	G-gamma	95	137	0.16	12.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P35133`	Arabidopsis thaliana	sp\|P35133\|UBC10_ARATH Ubiquitin-conjugating enzyme E2 10	97.300%	Swiss-Prot	High
`P35132`	Arabidopsis thaliana	sp\|P35132\|UBC9_ARATH SUMO-conjugating enzyme UBC9	96.600%	Swiss-Prot	High
`Q94F47`	Arabidopsis thaliana	sp\|Q94F47\|UBC28_ARATH Ubiquitin-conjugating enzyme E2 28	96.600%	Swiss-Prot	High
`Q8S919`	Oryza sativa subsp. japonica	sp\|Q8S919\|UBC5B_ORYSJ Ubiquitin-conjugating enzyme E2 5B	95.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card