TkA01G012460 | RubberDandelionOmics

Gene overview

TkA01G012460

Reference: TK1151 Chr: Chr01 Coordinates: 3278385-3278983 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

441 bp · TkA01G012460|TK1151|cDNA

ATGGCTCAAACCAGGTGGAGCATCAATTTCTTTGTAGCAATTGTTGCGGCAATAGCTACTTCAGTTTCTTCCAAAGAGTTTATTGTTGGCGATGACAAGGGTTGGACCCTCAACTTCGATTATCAAGCTTGGGCCTATGGCAAGGAGTTTGTCGTTGGTGATAAACTGATTTTCAAATACGCTGCTGGAAAACACAATGTGTTCAGAGTCGATGGAACATTCTTCCAACAATGCATGATTCCTCCGGTTAACGAAGCTCT...

CDS

Download CDS FASTA

441 bp · TkA01G012460|TK1151|CDS

ATGGCTCAAACCAGGTGGAGCATCAATTTCTTTGTAGCAATTGTTGCGGCAATAGCTACTTCAGTTTCTTCCAAAGAGTTTATTGTTGGCGATGACAAGGGTTGGACCCTCAACTTCGATTATCAAGCTTGGGCCTATGGCAAGGAGTTTGTCGTTGGTGATAAACTGATTTTCAAATACGCTGCTGGAAAACACAATGTGTTCAGAGTCGATGGAACATTCTTCCAACAATGCATGATTCCTCCGGTTAACGAAGCTCT...

Protein

Download Protein FASTA

146 aa · TkA01G012460|TK1151|PROTEIN

MAQTRWSINFFVAIVAAIATSVSSKEFIVGDDKGWTLNFDYQAWAYGKEFVVGDKLIFKYAAGKHNVFRVDGTFFQQCMIPPVNEALNSGYDVITLTTPGRKWYICGVGKHCLNGLKLFINVLPQYPPPPPPPPYHGARKLAPPNF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G012460`
TK1151 ID	TkA01G012460
OH-1004 ID	LXL04_005854
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.600
Protein coverage (%)	TK1151 85.616 / OH-1004 46.125 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G012460

Location Chr01:3278385-3278983 (+)

Description Similar to BCP: Blue copper protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g32300`	Uclacyanin 1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005854 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009610 response to symbiotic fungus Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009055 electron transfer activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

mtr:11427104

mtr:11437278

mtr:25498990

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.467

Rank 1 · TkA01G012460 · TK1151

Cell membrane0.146

Rank 2 · TkA01G012460 · TK1151

Endoplasmic reticulum0.120

Rank 3 · TkA01G012460 · TK1151

Lysosome / Vacuole0.085

Rank 4 · TkA01G012460 · TK1151

Plastid0.084

Rank 5 · TkA01G012460 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02298Cu_bind_like23-31 aa

PF02298Cu_bind_like35-115 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G012460	`PF02298`	Cu_bind_like	23	31	1.1e-22	80.5
TkA01G012460	`PF02298`	Cu_bind_like	35	115	1.1e-22	80.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82081`	Arabidopsis thaliana	sp\|O82081\|UCC1_ARATH Uclacyanin 1	34.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card