TkA01G012210 | RubberDandelionOmics

Gene overview

TkA01G012210

Reference: TK1151 Chr: Chr01 Coordinates: 3228283-3230123 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1214 bp · TkA01G012210|TK1151|cDNA

AAATTTGTGGATGTCAACAAGGACCGATCTCAACGAAGTTTATAACATCTTCTTACACCATTTTAGAGACTTCGACCAAAAAATATTCGGTTTCATGCCATCCGAAAAAAAAAAATTGTGTTTCAAAGTTTTATGTAAATAGGCATCTTAAATTGCAACCCAAATATAAACAAGGTAATTAGTCCATTAAAATGGCTATTAACAGGTTGAGGATCATCATCCTCATAGCAACCGTAGCAGGTCTAGCTATTGCCGTTTCG...

CDS

Download CDS FASTA

786 bp · TkA01G012210|TK1151|CDS

ATGGCTATTAACAGGTTGAGGATCATCATCCTCATAGCAACCGTAGCAGGTCTAGCTATTGCCGTTTCGGCCACCGAGCATGTAGTTGGTGGTGACAAAGGCTGGACTTACGGCTTCGATTATGTAACCTGGTCATTCAAACAAGAGTATTACGTTGGCGATAAACTTATTTTCAAATATCCGCCTGGAAAACACAATGTCTTTGAAGTCGATGAAGCGGGCATGGAAGCGTGTGTTATACCTTCTCCAGATAAAGCTTT...

Protein

Download Protein FASTA

261 aa · TkA01G012210|TK1151|PROTEIN

MAINRLRIIILIATVAGLAIAVSATEHVVGGDKGWTYGFDYVTWSFKQEYYVGDKLIFKYPPGKHNVFEVDEAGMEACVIPSPDKALTSGNDVITLETPGHKFYISGKKNDKGKYDCEEEGRMKFYINVLPRLVHGSDPVPSTGKQYVVGDDKGWTVNVDYQAWTNGKKFNIGDKLIFKYPKEQHNVFQTIDDTAYRECTIPPAQEALTSGYDVIAIEAPDTWFICGIGDHCNQGQKLYIHASDPGSKSPEFKGGRKLVK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G012210`
TK1151 ID	TkA01G012210
OH-1004 ID	LXL04_005855
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.600
Protein coverage (%)	TK1151 99.234 / OH-1004 48.776 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G012210

Location Chr01:3228283-3230123 (+)

Description Similar to BCP: Blue copper protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0681200`	May act as a carbohydrate transporter.	Thiourea and hydrogen peroxide priming improved K+ retention and source-sink relationship for mitigating salt stress in rice.2021 · DOI: 10.1038/s41598-020-80419-6

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005855 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009610 response to symbiotic fungus Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009055 electron transfer activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

mtr:25498990

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.516

Rank 1 · TkA01G012210 · TK1151

Endoplasmic reticulum0.121

Rank 2 · TkA01G012210 · TK1151

Lysosome / Vacuole0.121

Rank 3 · TkA01G012210 · TK1151

Cell membrane0.107

Rank 4 · TkA01G012210 · TK1151

Cytoplasm0.095

Rank 5 · TkA01G012210 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02298Cu_bind_like35-110 aa

PF12584TRAPPC10_C103-142 aa

PF02298Cu_bind_like155-236 aa

PF12584TRAPPC10_C204-228 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G012210	`PF02298`	Cu_bind_like	35	110	2e-40	137.4
TkA01G012210	`PF12584`	TRAPPC10_C	103	142	0.23	12.0
TkA01G012210	`PF02298`	Cu_bind_like	155	236	2e-40	137.4
TkA01G012210	`PF12584`	TRAPPC10_C	204	228	0.23	12.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A3BEP8`	Oryza sativa subsp. japonica	sp\|A3BEP8\|ENL18_ORYSJ Early nodulin-like protein 18	32.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card