TkA01G010860 | RubberDandelionOmics

Gene overview

TkA01G010860

Reference: TK1151 Chr: Chr01 Coordinates: 2947067-2949764 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1768 bp · TkA01G010860|TK1151|cDNA

TGAAACGAAGCATCCACCCAATCTCCATTCATCTCTCTCAGTGCAATCTTCTCCCTCCATTGTCATTGTTTCTACTGCTTCATTATTCACCTTGAGATCTGTAATCAGAAGCTACCTCACTCTCTCCTACATATTTCTCTTAATTCTACAGTCGGGAACCCTATCAAAACCCTTAACTTAAAACCGTCATCAGTTATATTGTATTTCACCATTTCAATGTCTCCCAGAGCTTCCTTTTCCGATGATTCGAGGATGATCAA...

CDS

Download CDS FASTA

1428 bp · TkA01G010860|TK1151|CDS

ATGTCTCCCAGAGCTTCCTTTTCCGATGATTCGAGGATGATCAAGAAGCCAATACCGAAATCTCTGTTACTCAGGGATTATCTACTCGACGATATGAGCTCGTGTTCTTCAAACGGCTTCCGGTCGTATCCTCGCCGGCAATGCTGCACCACGGTTCGATTCCTTGTGGAAATGGATCTTAACAGAAACAGTAAGCAGCCTCTAGAGCAGCAGCGGCGGTCGATCATGGAAAGCAAAAGCAAATGGAAATTGAAATCAAA...

Protein

Download Protein FASTA

475 aa · TkA01G010860|TK1151|PROTEIN

MSPRASFSDDSRMIKKPIPKSLLLRDYLLDDMSSCSSNGFRSYPRRQCCTTVRFLVEMDLNRNSKQPLEQQRRSIMESKSKWKLKSKPKPKSKQLSVVQRASAVMINAFKQFQFSGAGSPTTKANFLPRSLSRKLLRHGFWKKTDHHHNKEIKRLKSFGDFIKEKETTSPPPSPSPSQSQFSTAMITTTTMQLNSSTSNTTTSCSDSDFTATTGNSSEVNSAQKHVTNVSPENKKTTNGKTVGATTAAATATSTNYSPTT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G010860`
TK1151 ID	TkA01G010860
OH-1004 ID	LXL04_026770
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	29.200
Protein coverage (%)	TK1151 43.158 / OH-1004 45.409 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G010860`
Location	Chr01:2947067-2949764 (+)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_026770` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.474

Rank 1 · TkA01G010860 · TK1151

Nucleus0.394

Rank 2 · TkA01G010860 · TK1151

Cell membrane0.281

Rank 3 · TkA01G010860 · TK1151

Endoplasmic reticulum0.078

Rank 4 · TkA01G010860 · TK1151

Plastid0.039

Rank 5 · TkA01G010860 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14309DUF437867-144 aa

PF02020W2149-166 aa

PF26201Ig_SMCHD1_7th185-205 aa

PF26201Ig_SMCHD1_7th262-303 aa

PF26201Ig_SMCHD1_7th388-403 aa

PF14309DUF4378401-468 aa

PF02020W2416-450 aa

PF27759ATXN7L3B457-473 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G010860	`PF14309`	DUF4378	67	144	0.025	15.6
TkA01G010860	`PF02020`	W2	149	166	1.5	9.6
TkA01G010860	`PF26201`	Ig_SMCHD1_7th	185	205	0.38	11.6
TkA01G010860	`PF26201`	Ig_SMCHD1_7th	262	303	0.38	11.6
TkA01G010860	`PF26201`	Ig_SMCHD1_7th	388	403	0.38	11.6
TkA01G010860	`PF14309`	DUF4378	401	468	0.025	15.6
TkA01G010860	`PF02020`	W2	416	450	1.5	9.6
TkA01G010860	`PF27759`	ATXN7L3B	457	473	0.14	13.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card