TkA01G010140 | RubberDandelionOmics

Gene overview

TkA01G010140

Reference: TK1151 Chr: Chr01 Coordinates: 2760508-2763322 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1723 bp · TkA01G010140|TK1151|cDNA

ACCTTCGTTATTTATTTTTAGTTCCTGCCCACTCCCATCCTTTACCTCTACATTTCCCCCCTCCCATTTGACAATCACCTCTCTCTCTCTCTCTCTCTCTCAAATGCATAAACCAACTACTTCACCGTCCACCCGCCACCGCTAACCAATCACAAAAAATGGGCAAGGCATCAAAATTCTTCAAAGCCCTTTTCAGTTTCAAACCCTCCGATCCAACCCACCAACCACCTTCACGTTCCGACGTCAACAAACAACCCAAA...

CDS

Download CDS FASTA

1353 bp · TkA01G010140|TK1151|CDS

ATGGGCAAGGCATCAAAATTCTTCAAAGCCCTTTTCAGTTTCAAACCCTCCGATCCAACCCACCAACCACCTTCACGTTCCGACGTCAACAAACAACCCAAACGCCGCTGGAGCTTCATCAAATCAAACAAAGACGAACTCCACCACCACCACCACCACAATAACTCCGACACATTTAACCCATCACTCTCCCTCTCACGCAACACCCCACTTCACCATTCCACCGCTCAATCCGCCGGAGACGACCGAACAACGACCTC...

Protein

Download Protein FASTA

450 aa · TkA01G010140|TK1151|PROTEIN

MGKASKFFKALFSFKPSDPTHQPPSRSDVNKQPKRRWSFIKSNKDELHHHHHHNNSDTFNPSLSLSRNTPLHHSTAQSAGDDRTTTSTTHVIAVDVDPATTKLADAVVTTAHAAAEVVRMTSKTNTRYGYGLRKEWAAIKIQTYFRGYLSRKALRALKALVKLQALVRGHILRKQAAIDYRRLQALLRAQARARAGRFPITDSPQSNKGPQTPEKFERTRTTIHDHPSVLKNNVYKSYPRYDDEKILETDSMKHHLLPPR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G010140`
TK1151 ID	TkA01G010140
OH-1004 ID	LXL04_029639
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	42.600
Protein coverage (%)	TK1151 97.778 / OH-1004 58.284 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G010140

Location Chr01:2760508-2763322 (-)

Description Similar to MIZ1: Protein MIZU-KUSSEI 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g23060`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At5g62070`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At4g00820`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At3g16490`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At5g07240`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029639 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009658 chloroplast organization Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0010091 trichome branching Biological Process

GO:0010274 hydrotropism Biological Process

GO:0051592 response to calcium ion Biological Process

GO:1901020 negative regulation of calcium ion transmembrane transporter activity Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

KEGG gene cross-reference

ath:AT2G41660

ath:AT4G14750

ath:AT4G23060

ath:AT5G07240

ath:AT5G62070

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.407

Rank 1 · TkA01G010140 · TK1151

Cytoplasm0.381

Rank 2 · TkA01G010140 · TK1151

Nucleus0.371

Rank 3 · TkA01G010140 · TK1151

Endoplasmic reticulum0.048

Rank 4 · TkA01G010140 · TK1151

Plastid0.030

Rank 5 · TkA01G010140 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13178DUF400533-46 aa

PF00612IQ136-155 aa

PF00612IQ158-175 aa

PF13178DUF4005258-269 aa

PF13178DUF4005325-403 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G010140	`PF13178`	DUF4005	33	46	8.8e-11	43.0
TkA01G010140	`PF00612`	IQ	136	155	6.7e-10	38.6
TkA01G010140	`PF00612`	IQ	158	175	6.7e-10	38.6
TkA01G010140	`PF13178`	DUF4005	258	269	8.8e-11	43.0
TkA01G010140	`PF13178`	DUF4005	325	403	8.8e-11	43.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q2NNE0`	Arabidopsis thaliana	sp\|Q2NNE0\|IQD22_ARATH Protein IQ-DOMAIN 22	35.400%	Swiss-Prot	Medium
`Q9FIT1`	Arabidopsis thaliana	sp\|Q9FIT1\|IQD23_ARATH Protein IQ-DOMAIN 23	35.800%	Swiss-Prot	Medium
`F4JHN2`	Arabidopsis thaliana	sp\|F4JHN2\|IQD17_ARATH Protein IQ-DOMAIN 17	27.500%	Swiss-Prot	Low
`Q9LK76`	Arabidopsis thaliana	sp\|Q9LK76\|IQD26_ARATH Protein IQ-domain 26	33.200%	Swiss-Prot	Medium
`Q9LYP2`	Arabidopsis thaliana	sp\|Q9LYP2\|IQD24_ARATH Protein IQ-DOMAIN 24	32.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card