TkA01G009660 | RubberDandelionOmics

Gene overview

TkA01G009660

Reference: TK1151 Chr: Chr01 Coordinates: 2621144-2622236 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

813 bp · TkA01G009660|TK1151|cDNA

CTACTTTCTATTCTCTATCAATGTCTAGGATTCATCCTCGAACACCTTCTCTTTCCTCAACTTCACCTTACGTGAGTTCAAAGCTCGAACGTTTTACAATATGGATGAAGTCGTTGGTTTTTAACACTCATGGATGCACTGTCTACAATTCGAAAGGCGAAATCGTTTACAGAGTTGATAATTACGACAATAAGTGTGGCCACGAAGTTTACTTGATGGATATTCAAGGCAAAGTTCTCTACTCCTTACGACAAAAGAAG...

CDS

Download CDS FASTA

585 bp · TkA01G009660|TK1151|CDS

ATGTCTAGGATTCATCCTCGAACACCTTCTCTTTCCTCAACTTCACCTTACGTGAGTTCAAAGCTCGAACGTTTTACAATATGGATGAAGTCGTTGGTTTTTAACACTCATGGATGCACTGTCTACAATTCGAAAGGCGAAATCGTTTACAGAGTTGATAATTACGACAATAAGTGTGGCCACGAAGTTTACTTGATGGATATTCAAGGCAAAGTTCTCTACTCCTTACGACAAAAGAAGTTACGATTATTTGGATGTTA...

Protein

Download Protein FASTA

194 aa · TkA01G009660|TK1151|PROTEIN

MSRIHPRTPSLSSTSPYVSSKLERFTIWMKSLVFNTHGCTVYNSKGEIVYRVDNYDNKCGHEVYLMDIQGKVLYSLRQKKLRLFGCYDGYKWDDCSSNKQLWFHATKHRSICVNSCDHKARGCTYKIVRMKGKLGFKIVDEDRENALVAEIKQKQTTKGINFGDDVFTLSVQPFIDHSLIMAIVMVNGLINNQI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G009660`
TK1151 ID	TkA01G009660
OH-1004 ID	LXL04_029630
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	63.500
Protein coverage (%)	TK1151 100.000 / OH-1004 94.554 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G009660

Location Chr01:2621144-2622236 (-)

Description Similar to At3g14260: Protein LURP-one-related 11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g14260`	Might be related to the phospholipid scramblase and tubby-like superfamily of membrane tethered transcription factors.	No verified direct reference in this release
`At1g63410`	Might be related to the phospholipid scramblase and tubby-like superfamily of membrane tethered transcription factors.	No verified direct reference in this release
`At1g53870`	Might be related to the phospholipid scramblase and tubby-like superfamily of membrane tethered transcription factors.	No verified direct reference in this release
`At1g53890`	Might be related to the phospholipid scramblase and tubby-like superfamily of membrane tethered transcription factors.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029630 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G53870

ath:AT1G53890

ath:AT1G63410

ath:AT2G38640

ath:AT3G14260

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.513

Rank 1 · TkA01G009660 · TK1151

Cytoplasm0.481

Rank 2 · TkA01G009660 · TK1151

Cell membrane0.173

Rank 3 · TkA01G009660 · TK1151

Endoplasmic reticulum0.073

Rank 4 · TkA01G009660 · TK1151

Lysosome / Vacuole0.044

Rank 5 · TkA01G009660 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04525LOR24-186 aa

PF13585CHU_C35-58 aa

PF02428Prot_inhib_II37-49 aa

PF02428Prot_inhib_II86-125 aa

PF01817CM_2124-161 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G009660	`PF04525`	LOR	24	186	1.2e-31	111.2
TkA01G009660	`PF13585`	CHU_C	35	58	0.15	12.9
TkA01G009660	`PF02428`	Prot_inhib_II	37	49	0.8	10.9
TkA01G009660	`PF02428`	Prot_inhib_II	86	125	0.8	10.9
TkA01G009660	`PF01817`	CM_2	124	161	0.065	14.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LUM1`	Arabidopsis thaliana	sp\|Q9LUM1\|LOR11_ARATH Protein LURP-one-related 11	41.400%	Swiss-Prot	Medium
`Q9SH27`	Arabidopsis thaliana	sp\|Q9SH27\|LOR4_ARATH Protein LURP-one-related 4	42.000%	Swiss-Prot	Medium
`Q8LG32`	Arabidopsis thaliana	sp\|Q8LG32\|LOR2_ARATH Protein LURP-one-related 2	44.400%	Swiss-Prot	Medium
`Q67XV7`	Arabidopsis thaliana	sp\|Q67XV7\|LOR3_ARATH Protein LURP-one-related 3	44.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card