TkA01G007070 | RubberDandelionOmics

Gene overview

TkA01G007070

Reference: TK1151 Chr: Chr01 Coordinates: 1833079-1834069 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

757 bp · TkA01G007070|TK1151|cDNA

ACACATACTTTACCGATTCCATTACTAGTCCCCCGATGTTCTTCTGATGTTGTAATGTTGATTTTCGATTTCGATTAGGTTATTTGATTTTGATTTCGGCATCACAAGAAGCTTAAAGATCTGGATCTGGGAGACTTATTGATAGATGGCGGTGAAGAAGGTGGAGATGGAGATCCAAACATGTCGATGAACTTACTTACTGTTGCAGGTACAGGAAATGCAGCTTTTCTCGATGAACTTCTCAAAGCAAGACTCGATCC...

CDS

Download CDS FASTA

495 bp · TkA01G007070|TK1151|CDS

ATGTCGATGAACTTACTTACTGTTGCAGGTACAGGAAATGCAGCTTTTCTCGATGAACTTCTCAAAGCAAGACTCGATCCTGATATTAGCGACTCAAAAGGAAGAACCCCTTTGCACATCGCAGCATCTAAAGGGCATGAAGAATGTGTTTTGGTTCTTCTAAAACATGCATGTAACATACACCTTAGAGATATGGATGGAAATACTGCACTATGGGATGCCATATCATCAAACAACCATTCAATATTCGTGGGTAGGGT...

Protein

Download Protein FASTA

164 aa · TkA01G007070|TK1151|PROTEIN

MSMNLLTVAGTGNAAFLDELLKARLDPDISDSKGRTPLHIAASKGHEECVLVLLKHACNIHLRDMDGNTALWDAISSNNHSIFVGRVSIYRGLPMVRRKISCTEAAEFSPGWVLWTKLPFAADVLLLLVLVLPAALSCLSFVVILSMVFSLLVCCNPFTCGLMD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G007070`
TK1151 ID	TkA01G007070
OH-1004 ID	LXL04_001355
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 50.610 / OH-1004 9.893 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G007070

Location Chr01:1833079-1834069 (+)

Description Similar to AKT2: Potassium channel AKT2/3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g22200`	Highly selective and weak inward-rectifying potassium channel.	Loss of the AKT2/3 potassium channel affects sugar loading into the phloem of Arabidopsis.2002 · DOI: 10.1007/s00425-002-0895-1 Regulated expression of Arabidopsis shaker K+ channel genes involved in K+ uptake and distribution in the plant.2003 · DOI: 10.1023/a:1022597102282
`At2g26650`	May act as a highly selective inward-rectifying potassium channel mediating root potassium uptake under low K⁺ conditions.	Regulated expression of Arabidopsis shaker K+ channel genes involved in K+ uptake and distribution in the plant.2003 · DOI: 10.1023/a:1022597102282 A protein kinase, interacting with two calcineurin B-like proteins, regulates K+ transporter AKT1 in Arabidopsis.2006 · DOI: 10.1016/j.cell.2006.06.011 A Ca(2)+ signaling pathway regulates a K(+) channel for low-K response in Arabidopsis.2006 · DOI: 10.1073/pnas.0605129103 A protein phosphorylation/dephosphorylation network regulates a plant potassium channel.2007 · DOI: 10.1073/pnas.0707912104 High-affinity K(+) transport in Arabidopsis: AtHAK5 and AKT1 are vital for seedling establishment and postgermination growth under low-potassium conditions.2010 · DOI: 10.1104/pp.110.154369 A role for the AKT1 potassium channel in plant nutrition.1998 · DOI: 10.1126/science.280.5365.918

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0428700`	Probable inward-rectifying potassium channel.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001355 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006813 potassium ion transport Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0042391 regulation of membrane potential Biological Process

GO:0048767 root hair elongation Biological Process

GO:0090333 regulation of stomatal closure Biological Process

GO:1990573 potassium ion import across plasma membrane Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

KEGG gene cross-reference

ath:AT2G26650

ath:AT4G22200

ath:AT4G32500

dosa:Os01g0648000

dosa:Os05g0428700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.397

Rank 1 · TkA01G007070 · TK1151

Nucleus0.310

Rank 2 · TkA01G007070 · TK1151

Mitochondrion0.235

Rank 3 · TkA01G007070 · TK1151

Endoplasmic reticulum0.121

Rank 4 · TkA01G007070 · TK1151

Cell membrane0.097

Rank 5 · TkA01G007070 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24521Ank_KRIT14-55 aa

PF13606Ank_35-27 aa

PF12796Ank_29-82 aa

PF00023Ank11-31 aa

PF13637Ank_417-54 aa

PF13857Ank_520-71 aa

PF00023Ank34-64 aa

PF13606Ank_334-61 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G007070	`PF24521`	Ank_KRIT1	4	55	0.22	12.0
TkA01G007070	`PF13606`	Ank_3	5	27	8.5e-08	32.5
TkA01G007070	`PF12796`	Ank_2	9	82	3.6e-14	53.8
TkA01G007070	`PF00023`	Ank	11	31	8.4e-13	48.5
TkA01G007070	`PF13637`	Ank_4	17	54	1.3e-11	45.1
TkA01G007070	`PF13857`	Ank_5	20	71	3.7e-10	40.6
TkA01G007070	`PF00023`	Ank	34	64	8.4e-13	48.5
TkA01G007070	`PF13606`	Ank_3	34	61	8.5e-08	32.5
TkA01G007070	`PF13637`	Ank_4	41	82	1.3e-11	45.1
TkA01G007070	`PF00023`	Ank	66	82	8.4e-13	48.5
TkA01G007070	`PF13606`	Ank_3	66	82	8.5e-08	32.5
TkA01G007070	`PF10947`	DUF2628	105	153	0.18	13.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q38898`	Arabidopsis thaliana	sp\|Q38898\|AKT2_ARATH Potassium channel AKT2/3	67.500%	Swiss-Prot	Medium
`Q38998`	Arabidopsis thaliana	sp\|Q38998\|AKT1_ARATH Potassium channel AKT1	51.800%	Swiss-Prot	Low
`Q75HP9`	Oryza sativa subsp. japonica	sp\|Q75HP9\|AKT2_ORYSJ Potassium channel AKT2	51.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card