TkA01G006900 | RubberDandelionOmics

Gene overview

TkA01G006900

Reference: TK1151 Chr: Chr01 Coordinates: 1780930-1782394 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1200 bp · TkA01G006900|TK1151|cDNA

AAAAAAACCTTCTTCATCCTTAAACCCACCTACAAAATCCCAGTTTTTTCTCTGTTTCAATCGCCTTTCATCCGATCGATACCCAACAAACGAACTCTCCATCACCACAACCGACGGCATTACCAATTGACCCGGAAATTCTGCTATTCACAGCTAGCCCAAGAGCAATCCCACCGGAGTCGCGCCAATGTCATCGAAATCCTTGAAGAAAGAGGCCTGCTTGAAGCCATCACCGGCGATAACCTCCGTTCAATTTGTAC...

CDS

Download CDS FASTA

1200 bp · TkA01G006900|TK1151|CDS

AAAAAAACCTTCTTCATCCTTAAACCCACCTACAAAATCCCAGTTTTTTCTCTGTTTCAATCGCCTTTCATCCGATCGATACCCAACAAACGAACTCTCCATCACCACAACCGACGGCATTACCAATTGACCCGGAAATTCTGCTATTCACAGCTAGCCCAAGAGCAATCCCACCGGAGTCGCGCCAATGTCATCGAAATCCTTGAAGAAAGAGGCCTGCTTGAAGCCATCACCGGCGATAACCTCCGTTCAATTTGTAC...

Protein

Download Protein FASTA

399 aa · TkA01G006900|TK1151|PROTEIN

KKTFFILKPTYKIPVFSLFQSPFIRSIPNKRTLHHHNRRHYQLTRKFCYSQLAQEQSHRSRANVIEILEERGLLEAITGDNLRSICTDSSLRVYCGFDPTAESLHLGNLIGIIVLSWFLRCGHSAVALVGGATGRVGDPSGKSLERPELDIETLERNISGISGIVLKILGDISTEFTYQLLQGYDFVHLFKSENITVQIGGSDQWGNITAGTELIRKLHQSDSAFGLTFPLLLKSDGTKFGKSEDGAIWLSPSMLSPYKF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G006900`
TK1151 ID	TkA01G006900
OH-1004 ID	LXL04_005925
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	81.700
Protein coverage (%)	TK1151 100.000 / OH-1004 98.384 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G006900

Location Chr01:1780930-1782394 (+)

Description Similar to EMB2768: Tyrosine--tRNA ligase, chloroplastic/mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g02660`	Catalyzes the attachment of tyrosine to tRNA(Tyr) in a two-step reaction: tyrosine is first activated by ATP to form Tyr-AMP and then transferred to the acceptor end of tRNA(Tyr).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005925 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006437 tyrosyl-tRNA aminoacylation Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0043039 tRNA aminoacylation Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0004831 tyrosine-tRNA ligase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

KEGG gene cross-reference

ath:AT3G02660

gka:GK2803

pcu:PC_RS05635

rrs:RoseRS_2069

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.740

Rank 1 · TkA01G006900 · TK1151

Mitochondrion0.346

Rank 2 · TkA01G006900 · TK1151

Cytoplasm0.047

Rank 3 · TkA01G006900 · TK1151

Nucleus0.034

Rank 4 · TkA01G006900 · TK1151

Peroxisome0.015

Rank 5 · TkA01G006900 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00579tRNA-synt_1b90-157 aa

PF00579tRNA-synt_1b174-282 aa

PF22421SYY_C-terminal312-394 aa

PF16714TyrRSs_C339-366 aa

PF01479S4341-379 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G006900	`PF00579`	tRNA-synt_1b	90	157	4e-49	168.2
TkA01G006900	`PF00579`	tRNA-synt_1b	174	282	4e-49	168.2
TkA01G006900	`PF22421`	SYY_C-terminal	312	394	1.4e-09	38.4
TkA01G006900	`PF16714`	TyrRSs_C	339	366	0.015	15.8
TkA01G006900	`PF01479`	S4	341	379	6e-06	26.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M876`	Arabidopsis thaliana	sp\|Q9M876\|SYYM_ARATH Tyrosine--tRNA ligase, chloroplastic/mitochondrial	60.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card