TkA01G003510 | RubberDandelionOmics

Gene overview

TkA01G003510

Reference: TK1151 Chr: Chr01 Coordinates: 948592-951647 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1516 bp · TkA01G003510|TK1151|cDNA

TTTACTAACCAAAATAAAATACCAAAAATTGCTTAAAAATATAATTACTGAAAATATCTATGATTTGAAAAGTAATTTAATTTTGTAAAATGGAATTGATGGTTACAAAGAAAAAAAGGGGGATAATGGGTGTGTAGCCATCCGACCGATGTGACCCGACCCGGGTTGGTGCGACGCAAAGGAGCCCCAATTTTCCCCTAGGGGATTTTTCCCATTCAGAAATCATCTGCGAAAAACCAGATCTGCCGGCGTGCTTTTCC...

CDS

Download CDS FASTA

933 bp · TkA01G003510|TK1151|CDS

ATGACCGTGTCTGAAGATGAAGACGAATATCTAGCTCATTTTTTGGAATCCGAAGTTCTTTCAGAGATCTCCGATCAGGAAGATGCAAGATCAGAGAAAGAGGAGGTGCGACAGCCGAAGCGGCTTCGGGTGGAGCAAAACGGTGGCGTGAATAACCGATTAATAAATCCAAGGAGGATAGATGATGGTTTCTTTAGTAGAATTCCTCCAGAGCTCTTCCCTCATATCCTCAAGTTTCTCTCCTCGGAGGATCTTGTTTC...

Protein

Download Protein FASTA

310 aa · TkA01G003510|TK1151|PROTEIN

MTVSEDEDEYLAHFLESEVLSEISDQEDARSEKEEVRQPKRLRVEQNGGVNNRLINPRRIDDGFFSRIPPELFPHILKFLSSEDLVSCSLVCRFLNFASSDESLWRRLYCMRWGILPPTKNLRESAWKKLYIQRDEEDMVEFVRNCPIEFKEYYIQMQVAKRTQAPLPSQLKDDWMILDKSVADQVSIWKRSKGLTDKVFSDHNCSGETCSYYQIGDVFVCETTGYVHVCDDTCKDVVLDPENELLVCTISGHCFDRLLS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G003510`
TK1151 ID	TkA01G003510
OH-1004 ID	LXL04_005974
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 94.801 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G003510

Location Chr01:948592-951647 (-)

Description Similar to SKIP31: F-box protein SKIP31

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g45360`	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005974 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT5G45360

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.554

Rank 1 · TkA01G003510 · TK1151

Cytoplasm0.409

Rank 2 · TkA01G003510 · TK1151

Mitochondrion0.099

Rank 3 · TkA01G003510 · TK1151

Cell membrane0.052

Rank 4 · TkA01G003510 · TK1151

Golgi apparatus0.035

Rank 5 · TkA01G003510 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12937F-box-like65-110 aa

PF00646F-box65-106 aa

PF12937F-box-like125-133 aa

PF07999RHSP134-193 aa

PF12937F-box-like182-191 aa

PF03048Herpes_UL92208-259 aa

PF07999RHSP288-306 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G003510	`PF12937`	F-box-like	65	110	2.6e-13	50.2
TkA01G003510	`PF00646`	F-box	65	106	7.6e-08	32.7
TkA01G003510	`PF12937`	F-box-like	125	133	2.6e-13	50.2
TkA01G003510	`PF07999`	RHSP	134	193	0.26	11.4
TkA01G003510	`PF12937`	F-box-like	182	191	2.6e-13	50.2
TkA01G003510	`PF03048`	Herpes_UL92	208	259	0.0015	19.1
TkA01G003510	`PF07999`	RHSP	288	306	0.26	11.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FHK0`	Arabidopsis thaliana	sp\|Q9FHK0\|SKI31_ARATH F-box protein SKIP31	57.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card