TkA01G002610 | RubberDandelionOmics

Gene overview

TkA01G002610

Reference: TK1151 Chr: Chr01 Coordinates: 679450-684778 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3903 bp · TkA01G002610|TK1151|cDNA

GAATCCTGGCTCCGTCCCTGTTCATATAGGCAATGAGTAAAAATATGGTGTTTTAAATAAAAGTCACTTTTCGAATTTTAAGTTCTCAATATTATATAATATAATTAGTTTAGGCAAAACAAAAAATAAAACTATTTTTTGTAGACCATTGAGAAGACTACAACATATACTTGGTTGGAACTACAATTATTTGAGACACCAAAAATAATTTATGACACATTACGCTATATACCAACGGTAGATGGTCTCCACAACCCCCA...

CDS

Download CDS FASTA

2616 bp · TkA01G002610|TK1151|CDS

ATGAGGGATATGGAGGAGAAGGGTTCAGAAGATTGGAGGGAGACCGTAAAGAAGATGCTACCTCCTGGAGCTATACTACCTGACGAAAGTGACGAGCTTGATTACTCAATCGCTTTAGAATACAGGGGTCCTAACGTTTCTTATCAGGTTCCAAGAATCGAACCACTAGAAGTAAATTCCCGTTGTATCCCAACAGCATCAGTAGCCGAATCATTTTCAGATTCAAGAAGATCCATCAACCGCGACACCCCCCAAGTAAT...

Protein

Download Protein FASTA

871 aa · TkA01G002610|TK1151|PROTEIN

MRDMEEKGSEDWRETVKKMLPPGAILPDESDELDYSIALEYRGPNVSYQVPRIEPLEVNSRCIPTASVAESFSDSRRSINRDTPQVIDPIPLPVSYIAHMTDSPNQSPSRLSRSSESVVSVLHNGDSFSASPSGSPGSVHNQQNGTNGVRRGRAPVVTFNTVDRSERKEVGPGYNSEYVAVSKEKKKKKTTKRRVCYRCGKGKWETKESCLVCDAKYCSNCVLRAMGSMPEGRKCVTCIGEAIDESKRLDLGKNSRLLSR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G002610`
TK1151 ID	TkA01G002610
OH-1004 ID	LXL04_005998
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G002610

Location Chr01:679450-684778 (+)

Description Similar to XLG3: Extra-large guanine nucleotide-binding protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g31930`	Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems (By similarity).	Arabidopsis extra-large G proteins (XLGs) regulate root morphogenesis.2008 · DOI: 10.1111/j.1365-313x.2007.03335.x Regulation of root-wave response by extra large and conventional G proteins in Arabidopsis thaliana.2008 · DOI: 10.1111/j.1365-313x.2008.03506.x
`At2g23460`	Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems (By similarity).	Arabidopsis extra-large G proteins (XLGs) regulate root morphogenesis.2008 · DOI: 10.1111/j.1365-313x.2007.03335.x
`At4g34390`	Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems (By similarity).	Arabidopsis extra-large G proteins (XLGs) regulate root morphogenesis.2008 · DOI: 10.1111/j.1365-313x.2007.03335.x Arabidopsis extra large G-protein 2 (XLG2) interacts with the Gbeta subunit of heterotrimeric G protein and functions in disease resistance.2009 · DOI: 10.1093/mp/ssp001 Ca2+-dependent GTPase, extra-large G protein 2 (XLG2), promotes activation of DNA-binding protein related to vernalization 1 (RTV1), leading to activation of floral integrator genes and early flowering in Arabidopsis.2012 · DOI: 10.1074/jbc.m111.317412

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2Y3B5`	Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.	No verified direct reference in this release
`Os05g0333200`	Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems (Probable).	The U-box E3 ubiquitin ligase TUD1 functions with a heterotrimeric G α subunit to regulate Brassinosteroid-mediated growth in rice.2013 · DOI: 10.1371/journal.pgen.1003391

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005998 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009723 response to ethylene Biological Process

GO:0010476 gibberellin mediated signaling pathway Biological Process

GO:0034052 positive regulation of plant-type hypersensitive response Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0050832 defense response to fungus Biological Process

GO:2000280 regulation of root development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005834 heterotrimeric G-protein complex Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G31930

ath:AT2G23460

ath:AT4G34390

gmx:547804

gmx:547977

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.440

Rank 1 · TkA01G002610 · TK1151

Cytoplasm0.401

Rank 2 · TkA01G002610 · TK1151

Nucleus0.296

Rank 3 · TkA01G002610 · TK1151

Golgi apparatus0.064

Rank 4 · TkA01G002610 · TK1151

Endoplasmic reticulum0.056

Rank 5 · TkA01G002610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00025Arf444-471 aa

PF00503G-alpha448-836 aa

PF00025Arf689-711 aa

PF00025Arf725-761 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G002610	`PF00025`	Arf	444	471	0.0073	16.5
TkA01G002610	`PF00503`	G-alpha	448	836	1.9e-79	268.0
TkA01G002610	`PF00025`	Arf	689	711	0.0073	16.5
TkA01G002610	`PF00025`	Arf	725	761	0.0073	16.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C516`	Arabidopsis thaliana	sp\|Q9C516\|XLG3_ARATH Extra-large guanine nucleotide-binding protein 3	67.800%	Swiss-Prot	High
`O80462`	Arabidopsis thaliana	sp\|O80462\|XLG1_ARATH Extra-large guanine nucleotide-binding protein 1	53.000%	Swiss-Prot	High
`C6KIE6`	Arabidopsis thaliana	sp\|C6KIE6\|XLG2_ARATH Extra-large guanine nucleotide-binding protein 2	40.100%	Swiss-Prot	Medium
`A2Y3B5`	Oryza sativa subsp. indica	sp\|A2Y3B5\|GPA1_ORYSI Guanine nucleotide-binding protein alpha-1 subunit	38.700%	Swiss-Prot	Medium
`Q0DJ33`	Oryza sativa subsp. japonica	sp\|Q0DJ33\|GPA1_ORYSJ Guanine nucleotide-binding protein alpha-1 subunit	38.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card