TkA01G002350 | RubberDandelionOmics

Gene overview

TkA01G002350

Reference: TK1151 Chr: Chr01 Coordinates: 621549-625847 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2402 bp · TkA01G002350|TK1151|cDNA

GTTTTCCCCCAAAACCCCAATTAAGCCCTCATGTAAGAAAATTCTGTACTCTGCAATTCCAATCACTCAGTCCCATCACCAACAATGGCGGATGATCAAGGTTTTGAAACATGGGATAGCGAATTCTTGGAAAAAGCTATCCAAGCCACCGACGCCGCCGCTTGTTCTTCCTCCTCCTCAAACACTTATCAACCGCCACCAAAACTATTCCCGCCGCCTCCGCCACCCATTATGCTCCTCACATCAGTTATTCTCCCCCT...

CDS

Download CDS FASTA

1710 bp · TkA01G002350|TK1151|CDS

ATGAATCGAGCTCTCAGTAGTGCGCCTCCGAGAGAGCTGATTCAGAGATTGAAAGAGGACAATCACAGAAACGCTCCAGATATAGGTTTCGATTGCCCTGCGTCGTTGAATGGAATCAATCGAGGTCTCAATAGTGCGCCTCCGTTTCAATCTTCTTCTCGATTGCACGAAGAGGATAAACATTGCAAACAGCAGGAAATCAATCGGTTGAAGGAAGAGTTGGGAAGAGTATCGAAGGTGCTTACTAACCTGGAACAAGA...

Protein

Download Protein FASTA

569 aa · TkA01G002350|TK1151|PROTEIN

MNRALSSAPPRELIQRLKEDNHRNAPDIGFDCPASLNGINRGLNSAPPFQSSSRLHEEDKHCKQQEINRLKEELGRVSKVLTNLEQECLELRKDREKNEKHFRAVPPVNGSKDAEASCTTKSNTKSKNHFEEESIIHPGTKGVIPCKTVGVQTDEHTVSDELTIKNNLLITYHSRKLADIWEPGNDQQPRNNLVSKLFMACGTDLQVLFGCLGLNIPSKKTTTKMDSFKLDLYMDPTHCIQSVEAAKVSHLYITLTKISY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G002350`
TK1151 ID	TkA01G002350
OH-1004 ID	LXL04_005995
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	84.300
Protein coverage (%)	TK1151 98.243 / OH-1004 86.667 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G002350

Location Chr01:621549-625847 (+)

Description Similar to SUV2: Protein SENSITIVE TO UV 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g45610`	Required for tolerance to DNA-damaging and cross-linking agents such as UVB irradiation, gamma-radiation, aphidicolin, ionizing radiation and hydroxyurea (HU), cisplatin (CDDP) and mitomycin C (MMC).	The Arabidopsis ATRIP ortholog is required for a programmed response to replication inhibitors.2009 · DOI: 10.1111/j.1365-313x.2009.03975.x A UVB-hypersensitive mutant in Arabidopsis thaliana is defective in the DNA damage response.2009 · DOI: 10.1111/j.1365-313x.2009.03974.x SUV2, which encodes an ATR-related cell cycle checkpoint and putative plant ATRIP, is required for aluminium-dependent root growth inhibition in Arabidopsis.2017 · DOI: 10.1111/pce.12992

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005995 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006974 DNA damage response Biological Process

GO:0010044 response to aluminum ion Biological Process

GO:0010212 response to ionizing radiation Biological Process

GO:0010224 response to UV-B Biological Process

GO:0010332 response to gamma radiation Biological Process

GO:0051726 regulation of cell cycle Biological Process

GO:0072710 response to hydroxyurea Biological Process

GO:0072718 response to cisplatin Biological Process

GO:1902751 positive regulation of cell cycle G2/M phase transition Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0004721 phosphoprotein phosphatase activity Molecular Function

KEGG gene cross-reference

ath:AT5G45610

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.471

Rank 1 · TkA01G002350 · TK1151

Nucleus0.426

Rank 2 · TkA01G002350 · TK1151

Cell membrane0.099

Rank 3 · TkA01G002350 · TK1151

Golgi apparatus0.064

Rank 4 · TkA01G002350 · TK1151

Lysosome / Vacuole0.052

Rank 5 · TkA01G002350 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30963HDR150-101 aa

PF28619SUV2_M53-89 aa

PF11166DUF295153-101 aa

PF28968PMD1-like62-103 aa

PF28652SUV2_N174-299 aa

PF28619SUV2_M354-459 aa

PF28655SUV2_C472-564 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G002350	`PF30963`	HDR1	50	101	0.093	13.6
TkA01G002350	`PF28619`	SUV2_M	53	89	7.8e-37	126.5
TkA01G002350	`PF11166`	DUF2951	53	101	0.46	11.4
TkA01G002350	`PF28968`	PMD1-like	62	103	0.061	13.5
TkA01G002350	`PF28652`	SUV2_N	174	299	9.3e-44	149.6
TkA01G002350	`PF28619`	SUV2_M	354	459	7.8e-37	126.5
TkA01G002350	`PF28655`	SUV2_C	472	564	1e-31	110.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`C8KI33`	Arabidopsis thaliana	sp\|C8KI33\|SUV2_ARATH Protein SENSITIVE TO UV 2	33.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card