RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G001260
Reference: TK1151 Chr: Chr01 Coordinates: 271641-277392 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3645 bp · TkA01G001260|TK1151|cDNA

CTCACATTCATTATTTGCAACCTAAGTTCACTTTCAATGTACTTGCAAATCTTCTCTTCCTCCCAATTTTACATTCCAAATTGAAACATCATGTCGATCCTCCAAAAACTGGATCACTTTAGGTTTCCGCTTGAAGACATAAAAAAGGCAACCAACAATTTTAGTTCTGAAAATGTTATTGGCCCAGGTGGTTATGGGATAGTGTATAAAGGAGAGCTCTTACACTCGAAAGTAGTTGTCACAATTGCAGCAAAGCGGGT...

CDS

Download CDS FASTA

4191 bp · TkA01G001260|TK1151|CDS

ATGTCGATCCTCCAAAAACTGGATCACTTTAGGTTTCCGCTTGAAGACATAAAAAAGGCAACCAACAATTTTAGTTCTGAAAATGTTATTGGCCCAGGTGGTTATGGGATAGTGTATAAAGGAGAGCTCTTACACTCGAAAGTAGTTGTCACAATTGCAGCAAAGCGGGTTGATAGGAGATTTGGCCATGGAGAAAGCCATTTCTTGAACGAAATCAGAGTGCTTTCTTTATATAAACATGTAAATATTGTCCCTTTCAT...

Protein

Download Protein FASTA

1396 aa · TkA01G001260|TK1151|PROTEIN

MSILQKLDHFRFPLEDIKKATNNFSSENVIGPGGYGIVYKGELLHSKVVVTIAAKRVDRRFGHGESHFLNEIRVLSLYKHVNIVPFIGFCDEYNEKILVEKFAAYGSLDNYVSSTKLNWMNRIQICLGAARGLNYLHNGLEGHTVFHRDIRSRTILLDTNWEPKIAGLGVSMMDSMHHDTDYGIIGAPGYVDPTLLQTGIVTKESDVYSFGMVLFEVLCGRLTYQTNENEFLGTVARVHYGNGTLNEIIDPILRKQMNQD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G001260
TK1151 IDTkA01G001260
OH-1004 IDLXL04_006002
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)99.800
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G001260
LocationChr01:271641-277392 (+)
DescriptionSimilar to At5g39000: Putative receptor-like protein kinase At5g39000
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g39000 Putative receptor-like protein kinase At5g39000. No verified direct reference in this release
At5g59700 Probable receptor-like protein kinase At5g59700. No verified direct reference in this release
At5g38990 Probable receptor-like protein kinase At5g38990. No verified direct reference in this release
At2g39360 Probable receptor-like protein kinase At2g39360. No verified direct reference in this release
At3g46290 Receptor-like protein kinase required for cell elongation during vegetative growth, mostly in a brassinosteroid-(BR-) independent manner.
Three related receptor-like kinases are required for optimal cell elongation in Arabidopsis thaliana.2009 · DOI: 10.1073/pnas.0812346106

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_006002 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0010038 response to metal ion Biological Process
GO:0005576 extracellular region Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0009536 plastid Cellular Component
GO:0004672 protein kinase activity Molecular Function
GO:0004674 protein serine/threonine kinase activity Molecular Function
GO:0004714 transmembrane receptor protein tyrosine kinase activity Molecular Function
GO:0005524 ATP binding Molecular Function
KEGG gene cross-reference
ath:AT5G38990
ath:AT5G39000
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.561
Rank 1 · TkA01G001260 · TK1151
Cell membrane0.302
Rank 2 · TkA01G001260 · TK1151
Nucleus0.291
Rank 3 · TkA01G001260 · TK1151
Endoplasmic reticulum0.049
Rank 4 · TkA01G001260 · TK1151
Lysosome / Vacuole0.040
Rank 5 · TkA01G001260 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase25-289 aa
PF07714PK_Tyr_Ser-Thr27-290 aa
PF01636APH143-161 aa
PF30520RNase_R_N195-209 aa
PF30520RNase_R_N288-299 aa
PF00069Pkinase349-363 aa
PF07714PK_Tyr_Ser-Thr352-655 aa
PF00069Pkinase394-653 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA01G001260PF00069Pkinase252894e-92309.0
TkA01G001260PF07714PK_Tyr_Ser-Thr272909e-108360.2
TkA01G001260PF01636APH1431610.411.1
TkA01G001260PF30520RNase_R_N1952090.04914.3
TkA01G001260PF30520RNase_R_N2882990.04914.3
TkA01G001260PF00069Pkinase3493634e-92309.0
TkA01G001260PF07714PK_Tyr_Ser-Thr3526559e-108360.2
TkA01G001260PF00069Pkinase3946534e-92309.0
TkA01G001260PF30520RNase_R_N4704950.04914.3
TkA01G001260PF01636APH4825270.411.1
TkA01G001260PF30520RNase_R_N6526750.04914.3
TkA01G001260PF07714PK_Tyr_Ser-Thr6849449e-108360.2
TkA01G001260PF00069Pkinase6899424e-92309.0
TkA01G001260PF30520RNase_R_N9419550.04914.3
TkA01G001260PF14299PP2102311483.8e-33115.3
TkA01G001260PF14299PP2123113953.8e-33115.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9FID8Arabidopsis thalianasp|Q9FID8|Y5900_ARATH Putative receptor-like protein kinase At5g3900036.000%Swiss-ProtLow
Q9FN92Arabidopsis thalianasp|Q9FN92|Y5597_ARATH Probable receptor-like protein kinase At5g5970034.600%Swiss-ProtLow
Q9FID9Arabidopsis thalianasp|Q9FID9|Y5389_ARATH Probable receptor-like protein kinase At5g3899035.800%Swiss-ProtLow
O80623Arabidopsis thalianasp|O80623|Y2393_ARATH Probable receptor-like protein kinase At2g3936037.700%Swiss-ProtLow
Q9LX66Arabidopsis thalianasp|Q9LX66|HERK_ARATH Receptor-like protein kinase HERK 138.100%Swiss-ProtLow

JBrowse

View in Genome Browser