LXL04_039762 | RubberDandelionOmics

Gene overview

LXL04_039762

Reference: OH-1004 Chr: JAJTUU010000036.1 Coordinates: 252403-253713 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1311 bp · LXL04_039762|LXL04_039762|OH1004|cDNA

ATGGCTTCTTCTCTCTCCCTTATCCTTTTCTACTTCATCTTCCTATCAATCTCCCTCTCCTCCGCCGTCGTCCCTCTCGCCGACACTTTCCACTATGTCAACCAAGGCGATTTCGGAGAATTCGATTCCGAATACGCCCCAAGCTACCGCCCCCTTCCGCCATTCACCTCCCCATTCCAGCTCTGTTTCTACAACACCACCCCCGGCGTCTACACCCTCAGCCTCCGAATGGGAACCAGACGTGACAACGCGGTCATGCG...

CDS

Download CDS FASTA

1311 bp · LXL04_039762|LXL04_039762|OH1004|CDS

ATGGCTTCTTCTCTCTCCCTTATCCTTTTCTACTTCATCTTCCTATCAATCTCCCTCTCCTCCGCCGTCGTCCCTCTCGCCGACACTTTCCACTATGTCAACCAAGGCGATTTCGGAGAATTCGATTCCGAATACGCCCCAAGCTACCGCCCCCTTCCGCCATTCACCTCCCCATTCCAGCTCTGTTTCTACAACACCACCCCCGGCGTCTACACCCTCAGCCTCCGAATGGGAACCAGACGTGACAACGCGGTCATGCG...

Protein

Download Protein FASTA

436 aa · LXL04_039762|LXL04_039762|OH1004|PROTEIN

MASSLSLILFYFIFLSISLSSAVVPLADTFHYVNQGDFGEFDSEYAPSYRPLPPFTSPFQLCFYNTTPGVYTLSLRMGTRRDNAVMRWVWEANRGNPVGENATFSFTSAGNLVLAHADGRIAWQTNTANKGVVGFAILETGNIVLRDSKGSFVWQSFDSPTDTLLFGQSLRIGGPTTLVSRASTTNNVNGVYSFVLEPKRLAMYYKTTMRYWASTFPELNQRNVTIVNATLEIQETEYEENYFNSLKCRLSNSGSQPYLD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_039762`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_039762

Location JAJTUU010000036.1:252403-253713 (+)

Description Similar to At1g78850: EP1-like glycoprotein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g78850`	May be involved in a cell-to cell programmed cell death (PCD) signaling mechanism.	No verified direct reference in this release
`At1g78860`	EP1-like glycoprotein 4.	No verified direct reference in this release
`At1g78830`	EP1-like glycoprotein 2.	No verified direct reference in this release
`At1g78820`	EP1-like glycoprotein 1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039762 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006833 water transport Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:1904383 response to sodium phosphate Biological Process

GO:1990641 response to iron ion starvation Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0048046 apoplast Cellular Component

KEGG gene cross-reference

ath:AT1G78820

ath:AT1G78830

ath:AT1G78850

ath:AT1G78860

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.612

Rank 1 · LXL04_039762 · OH-1004

Cell membrane0.192

Rank 2 · LXL04_039762 · OH-1004

Endoplasmic reticulum0.091

Rank 3 · LXL04_039762 · OH-1004

Cytoplasm0.052

Rank 4 · LXL04_039762 · OH-1004

Plastid0.044

Rank 5 · LXL04_039762 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01453.31B_lectin89-172 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_039762	`PF01453.31`	B_lectin	89	172	1.1e-18	68.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZVA4`	Arabidopsis thaliana	EP1-like glycoprotein 3	45.309%	Swiss-Prot	moderate database homology
`Q9ZVA5`	Arabidopsis thaliana	EP1-like glycoprotein 4	45.169%	Swiss-Prot	moderate database homology
`Q9ZVA2`	Arabidopsis thaliana	EP1-like glycoprotein 2	43.886%	Swiss-Prot	moderate database homology
`Q9ZVA1`	Arabidopsis thaliana	EP1-like glycoprotein 1	41.921%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card